Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   GKS41_RS14280 Genome accession   NZ_CP047268
Coordinates   2910750..2910923 (+) Length   57 a.a.
NCBI ID   WP_159354372.1    Uniprot ID   -
Organism   Bacillus velezensis strain DH8043     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2905750..2915923
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GKS41_RS14265 gcvT 2906563..2907663 (-) 1101 WP_061890721.1 glycine cleavage system aminomethyltransferase GcvT -
  GKS41_RS14270 - 2908087..2909757 (+) 1671 WP_038461530.1 DEAD/DEAH box helicase -
  GKS41_RS14275 - 2909779..2910573 (+) 795 WP_014418368.1 YqhG family protein -
  GKS41_RS14280 sinI 2910750..2910923 (+) 174 WP_159354372.1 anti-repressor SinI Regulator
  GKS41_RS14285 sinR 2910957..2911292 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  GKS41_RS14290 tasA 2911340..2912125 (-) 786 WP_017418136.1 biofilm matrix protein TasA -
  GKS41_RS14295 sipW 2912190..2912774 (-) 585 WP_012117977.1 signal peptidase I SipW -
  GKS41_RS14300 tapA 2912746..2913417 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  GKS41_RS14305 - 2913676..2914005 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  GKS41_RS14310 - 2914046..2914225 (-) 180 WP_003153093.1 YqzE family protein -
  GKS41_RS14315 comGG 2914282..2914659 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  GKS41_RS14320 comGF 2914660..2915055 (-) 396 WP_021494311.1 competence type IV pilus minor pilin ComGF -
  GKS41_RS14325 comGE 2915069..2915383 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  GKS41_RS14330 comGD 2915367..2915804 (-) 438 WP_159354373.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6570.53 Da        Isoelectric Point: 10.2093

>NTDB_id=412016 GKS41_RS14280 WP_159354372.1 2910750..2910923(+) (sinI) [Bacillus velezensis strain DH8043]
MKNAKTGFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=412016 GKS41_RS14280 WP_159354372.1 2910750..2910923(+) (sinI) [Bacillus velezensis strain DH8043]
ATGAAAAATGCAAAAACAGGATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702

Multiple sequence alignment