Detailed information    

insolico Bioinformatically predicted

Overview


Name   CJE1441   Type   Regulator
Locus tag   GR340_RS03145 Genome accession   NZ_CP047197
Coordinates   596768..597421 (-) Length   217 a.a.
NCBI ID   WP_060786368.1    Uniprot ID   -
Organism   Campylobacter coli strain JZ_1_95     
Function   repress natural transformation (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 569159..616149 596768..597421 within 0


Gene organization within MGE regions


Location: 569159..616149
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GR340_RS02965 (GR340_02915) - 569159..570532 (+) 1374 WP_002780905.1 replicative DNA helicase -
  GR340_RS02970 (GR340_02920) - 570666..570806 (-) 141 WP_002790042.1 hypothetical protein -
  GR340_RS02975 - 570769..570897 (-) 129 WP_002780907.1 hypothetical protein -
  GR340_RS02980 - 570890..571006 (-) 117 WP_002780908.1 EexN family lipoprotein -
  GR340_RS02985 (GR340_02930) - 571948..572238 (+) 291 WP_002788257.1 hypothetical protein -
  GR340_RS02990 (GR340_02935) - 572225..572566 (+) 342 WP_002788260.1 HNH endonuclease signature motif containing protein -
  GR340_RS02995 (GR340_02940) - 572825..573460 (+) 636 WP_277737527.1 P27 family phage terminase small subunit -
  GR340_RS03000 (GR340_02945) - 573464..575089 (+) 1626 WP_011049938.1 terminase TerL endonuclease subunit -
  GR340_RS03005 (GR340_02950) - 575144..575578 (+) 435 WP_002913302.1 type II toxin-antitoxin system PemK/MazF family toxin -
  GR340_RS03010 (GR340_02955) - 575737..576909 (+) 1173 WP_002788272.1 phage portal protein -
  GR340_RS03015 (GR340_02960) - 576906..577448 (+) 543 WP_002800770.1 HK97 gp10 family phage protein -
  GR340_RS03020 (GR340_02965) - 577449..577799 (+) 351 WP_002788276.1 hypothetical protein -
  GR340_RS03025 (GR340_02970) - 577787..578050 (-) 264 WP_002869971.1 type II toxin-antitoxin system RelE/ParE family toxin -
  GR340_RS03030 (GR340_02975) - 578047..578271 (-) 225 WP_002869970.1 DUF6290 family protein -
  GR340_RS03035 (GR340_02980) - 578418..579398 (+) 981 WP_002788279.1 hypothetical protein -
  GR340_RS03040 (GR340_02985) - 579395..579751 (+) 357 WP_002788281.1 hypothetical protein -
  GR340_RS03045 (GR340_02990) - 579832..580047 (+) 216 WP_002788282.1 hypothetical protein -
  GR340_RS03050 (GR340_02995) - 580039..580377 (-) 339 WP_002788283.1 hypothetical protein -
  GR340_RS03055 (GR340_03000) - 580437..586136 (+) 5700 WP_277737528.1 hypothetical protein -
  GR340_RS03060 (GR340_03005) - 586149..587018 (+) 870 WP_002788286.1 hypothetical protein -
  GR340_RS03065 (GR340_03010) - 587104..587661 (+) 558 WP_002788287.1 HK97 family phage prohead protease -
  GR340_RS03070 (GR340_03015) - 587720..588844 (+) 1125 WP_341535511.1 phage major capsid protein -
  GR340_RS03075 (GR340_03020) - 588855..589106 (+) 252 WP_002788291.1 hypothetical protein -
  GR340_RS03080 (GR340_03025) - 589103..589540 (+) 438 WP_277737530.1 hypothetical protein -
  GR340_RS03085 (GR340_03030) - 589553..589870 (+) 318 WP_002788295.1 head-tail adaptor protein -
  GR340_RS03090 (GR340_03035) - 589867..590499 (+) 633 WP_002869967.1 hypothetical protein -
  GR340_RS03095 (GR340_03040) - 590492..592057 (+) 1566 WP_215445535.1 hypothetical protein -
  GR340_RS03100 (GR340_03045) - 592059..592508 (+) 450 WP_215445536.1 hypothetical protein -
  GR340_RS03105 (GR340_03050) - 592521..593156 (+) 636 WP_002789149.1 DUF4376 domain-containing protein -
  GR340_RS03110 (GR340_03055) - 593153..593536 (+) 384 WP_002869963.1 hypothetical protein -
  GR340_RS03115 (GR340_03060) - 593529..593903 (+) 375 WP_004306042.1 DUF1353 domain-containing protein -
  GR340_RS03120 (GR340_03065) - 593900..595183 (+) 1284 WP_277737531.1 hypothetical protein -
  GR340_RS03125 (GR340_03070) - 595232..595693 (+) 462 WP_060786366.1 DUF5675 family protein -
  GR340_RS03130 (GR340_03075) - 595922..596341 (+) 420 WP_060786367.1 hypothetical protein -
  GR340_RS03135 (GR340_03080) - 596259..596456 (+) 198 WP_002870262.1 hypothetical protein -
  GR340_RS03140 (GR340_03085) - 596470..596751 (-) 282 WP_002870263.1 PLDc N-terminal domain-containing protein -
  GR340_RS03145 (GR340_03090) CJE1441 596768..597421 (-) 654 WP_060786368.1 DNA/RNA non-specific endonuclease Regulator
  GR340_RS03150 (GR340_03095) - 597418..597768 (-) 351 WP_048818574.1 hypothetical protein -
  GR340_RS03155 (GR340_03100) - 597776..598696 (-) 921 WP_070216836.1 DUF6731 family protein -
  GR340_RS03160 (GR340_03105) - 598875..599192 (-) 318 WP_060786369.1 hypothetical protein -
  GR340_RS03165 (GR340_03110) - 599196..599579 (-) 384 WP_060786370.1 helix-turn-helix domain-containing protein -
  GR340_RS03170 (GR340_03115) - 599794..599997 (+) 204 WP_060786371.1 hypothetical protein -
  GR340_RS03175 (GR340_03120) - 599994..600278 (+) 285 WP_002788580.1 hypothetical protein -
  GR340_RS03180 (GR340_03125) - 600709..601440 (+) 732 WP_002801548.1 phage regulatory protein/antirepressor Ant -
  GR340_RS03185 (GR340_03130) - 601493..601780 (+) 288 WP_002787279.1 YopX family protein -
  GR340_RS03190 (GR340_03135) - 601837..602100 (+) 264 WP_002787281.1 hypothetical protein -
  GR340_RS03195 (GR340_03140) - 602066..602296 (+) 231 WP_002787283.1 hypothetical protein -
  GR340_RS03200 (GR340_03145) - 602434..603201 (+) 768 WP_277737532.1 hypothetical protein -
  GR340_RS03205 (GR340_03150) - 603215..603451 (+) 237 WP_277737533.1 transcriptional regulator -
  GR340_RS03210 (GR340_03155) - 603839..604159 (+) 321 WP_060786175.1 hypothetical protein -
  GR340_RS03215 (GR340_03160) - 604238..604552 (+) 315 WP_060786176.1 hypothetical protein -
  GR340_RS03220 (GR340_03165) - 604489..605250 (+) 762 WP_002869676.1 hypothetical protein -
  GR340_RS03225 (GR340_03170) - 605259..605483 (+) 225 WP_011049924.1 hypothetical protein -
  GR340_RS03235 (GR340_03175) - 605484..605854 (+) 371 Protein_621 hypothetical protein -
  GR340_RS03240 (GR340_03180) - 605838..606104 (+) 267 WP_002787304.1 hypothetical protein -
  GR340_RS03245 (GR340_03185) - 606082..606837 (+) 756 WP_250426837.1 site-specific DNA-methyltransferase -
  GR340_RS03250 (GR340_03190) - 606855..607208 (+) 354 WP_052799158.1 hypothetical protein -
  GR340_RS03255 (GR340_03195) - 607210..607416 (+) 207 WP_002787309.1 helix-turn-helix domain-containing protein -
  GR340_RS03260 (GR340_03200) - 607413..608588 (-) 1176 WP_002787311.1 site-specific integrase -
  GR340_RS03270 (GR340_03210) - 608923..610023 (-) 1101 WP_002780911.1 FtsW/RodA/SpoVE family cell cycle protein -
  GR340_RS03275 (GR340_03215) - 610102..611067 (+) 966 WP_002784319.1 RluA family pseudouridine synthase -
  GR340_RS03280 (GR340_03220) - 611015..612247 (+) 1233 WP_002780915.1 fibronectin type III domain-containing protein -
  GR340_RS03285 (GR340_03225) trmB 612247..613443 (+) 1197 WP_002780917.1 tRNA (guanosine(46)-N7)-methyltransferase TrmB -
  GR340_RS03290 (GR340_03230) - 613492..614157 (+) 666 WP_002784315.1 ABC transporter ATP-binding protein -
  GR340_RS03295 (GR340_03235) - 614144..614950 (+) 807 WP_002799567.1 FtsX-like permease family protein -
  GR340_RS03300 (GR340_03240) - 614947..616149 (+) 1203 WP_002811044.1 M23 family metallopeptidase -

Sequence


Protein


Download         Length: 217 a.a.        Molecular weight: 25594.02 Da        Isoelectric Point: 9.7448

>NTDB_id=411449 GR340_RS03145 WP_060786368.1 596768..597421(-) (CJE1441) [Campylobacter coli strain JZ_1_95]
MKKLILLPLLSTLAFADYNQYKPSEDFAKYFTKQNCSQVLDKFYYINYYDYNYKGTKAVAYKLEADNLKGEQIKKRPRFE
DDTNIPKKYRTTWSDYKNSGYDRGHTISNASMRKTTQAQRSTFLMSNITPQNPQINQRVWNKIEKRERQVALKLGSLEVL
NLVNYDSNPQRIKNNIAVPSSYVKILKGDNFKECYQVPNHEVDDESIRIYKVQCDNF

Nucleotide


Download         Length: 654 bp        

>NTDB_id=411449 GR340_RS03145 WP_060786368.1 596768..597421(-) (CJE1441) [Campylobacter coli strain JZ_1_95]
ATAAAAAAACTCATACTTTTACCATTGTTATCCACTCTAGCCTTTGCTGATTATAATCAATACAAACCAAGTGAAGATTT
TGCCAAGTATTTTACTAAGCAAAACTGCTCACAAGTTTTAGATAAATTTTATTATATTAATTACTATGATTATAATTATA
AAGGCACTAAAGCTGTAGCTTATAAACTAGAAGCAGATAATCTAAAAGGCGAACAAATCAAAAAACGCCCACGCTTTGAA
GATGATACAAATATACCTAAAAAATACCGCACTACATGGAGTGATTATAAAAACAGCGGTTATGATAGAGGGCATACTAT
TTCTAATGCTTCAATGAGAAAAACAACTCAAGCTCAAAGAAGCACTTTTTTAATGAGCAATATTACTCCACAAAATCCAC
AAATCAATCAAAGGGTTTGGAACAAGATTGAAAAAAGAGAAAGACAAGTAGCTTTAAAACTTGGAAGTTTAGAAGTTTTA
AATTTGGTTAATTATGATAGTAATCCACAAAGAATAAAAAACAATATAGCTGTGCCAAGCTCTTATGTTAAGATCTTAAA
AGGTGATAATTTTAAAGAATGTTATCAAGTGCCAAATCATGAAGTCGATGATGAGAGTATAAGAATATATAAGGTACAAT
GTGACAATTTTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  CJE1441 Campylobacter jejuni RM1221

92.166

100

0.922

  CJE0566 Campylobacter jejuni RM1221

90.698

99.078

0.899


Multiple sequence alignment