Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   GE573_RS05055 Genome accession   NZ_CP047119
Coordinates   970287..970427 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain AK-0     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 965287..975427
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GE573_RS05030 (GE573_01001) - 965633..966016 (-) 384 WP_012118312.1 hotdog fold thioesterase -
  GE573_RS05035 (GE573_01002) comA 966038..966682 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  GE573_RS05040 (GE573_01003) comP 966763..969063 (-) 2301 WP_032867184.1 histidine kinase Regulator
  GE573_RS05045 (GE573_01004) comX 969077..969250 (-) 174 WP_012118314.1 competence pheromone ComX -
  GE573_RS05050 (GE573_01005) - 969219..970079 (-) 861 WP_157774448.1 polyprenyl synthetase family protein -
  GE573_RS05055 (GE573_01006) degQ 970287..970427 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  GE573_RS05060 (GE573_01007) - 970892..971233 (+) 342 WP_015418107.1 hypothetical protein -
  GE573_RS05065 (GE573_01008) - 971240..972463 (-) 1224 WP_015418108.1 EAL and HDOD domain-containing protein -
  GE573_RS05070 (GE573_01009) - 972593..974059 (-) 1467 WP_020954301.1 nicotinate phosphoribosyltransferase -
  GE573_RS05075 (GE573_01010) - 974077..974628 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  GE573_RS05080 (GE573_01011) - 974726..975124 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=410663 GE573_RS05055 WP_003152043.1 970287..970427(-) (degQ) [Bacillus velezensis strain AK-0]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=410663 GE573_RS05055 WP_003152043.1 970287..970427(-) (degQ) [Bacillus velezensis strain AK-0]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment