Detailed information
Overview
| Name | pilN | Type | Machinery gene |
| Locus tag | GPW72_RS17245 | Genome accession | NZ_CP046744 |
| Coordinates | 2549549..2550133 (+) | Length | 194 a.a. |
| NCBI ID | WP_000902745.1 | Uniprot ID | A0A0H6BVQ2 |
| Organism | Vibrio cholerae strain 3569-08 | ||
| Function | assembly of type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2515173..2557222 | 2549549..2550133 | within | 0 |
Gene organization within MGE regions
Location: 2515173..2557222
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GPW72_RS16980 | - | 2515173..2515709 (-) | 537 | WP_001065600.1 | hypothetical protein | - |
| GPW72_RS16985 | - | 2515709..2516560 (-) | 852 | WP_001895339.1 | hypothetical protein | - |
| GPW72_RS16990 | - | 2516560..2517147 (-) | 588 | WP_000510163.1 | putative phage tail protein | - |
| GPW72_RS16995 | - | 2517132..2518199 (-) | 1068 | WP_001147110.1 | baseplate J/gp47 family protein | - |
| GPW72_RS17000 | - | 2518189..2518638 (-) | 450 | WP_000095018.1 | phage GP46 family protein | - |
| GPW72_RS17005 | - | 2518641..2519258 (-) | 618 | WP_170826454.1 | phage baseplate assembly protein V | - |
| GPW72_RS17010 | - | 2519252..2520331 (-) | 1080 | WP_001286435.1 | phage baseplate assembly protein | - |
| GPW72_RS17015 | - | 2520324..2521643 (-) | 1320 | WP_000863380.1 | DNA circularization N-terminal domain-containing protein | - |
| GPW72_RS17020 | - | 2521655..2523358 (-) | 1704 | WP_001284562.1 | tape measure protein | - |
| GPW72_RS17025 | - | 2523484..2523843 (-) | 360 | WP_000996598.1 | phage tail assembly protein | - |
| GPW72_RS17030 | - | 2523843..2524196 (-) | 354 | WP_001895328.1 | phage tail tube protein | - |
| GPW72_RS17035 | - | 2524211..2525695 (-) | 1485 | WP_001128141.1 | phage tail sheath subtilisin-like domain-containing protein | - |
| GPW72_RS17040 | - | 2525698..2525898 (-) | 201 | WP_000437435.1 | DUF2635 domain-containing protein | - |
| GPW72_RS17045 | - | 2525912..2526511 (-) | 600 | WP_000100991.1 | hypothetical protein | - |
| GPW72_RS17050 | - | 2526508..2527050 (-) | 543 | WP_000513061.1 | phage virion morphogenesis protein | - |
| GPW72_RS17055 | - | 2527050..2527484 (-) | 435 | WP_001029276.1 | DUF1320 domain-containing protein | - |
| GPW72_RS17060 | - | 2527490..2528065 (-) | 576 | WP_000004756.1 | hypothetical protein | - |
| GPW72_RS17065 | - | 2528154..2529053 (-) | 900 | WP_001218331.1 | Mu-like prophage major head subunit gpT family protein | - |
| GPW72_RS17070 | - | 2529056..2530012 (-) | 957 | WP_001262460.1 | phage protease | - |
| GPW72_RS17075 | - | 2530345..2530629 (-) | 285 | WP_001249579.1 | hypothetical protein | - |
| GPW72_RS17080 | - | 2530629..2531264 (-) | 636 | WP_000638762.1 | hypothetical protein | - |
| GPW72_RS17085 | - | 2531261..2531773 (-) | 513 | WP_000638754.1 | tail needle knob protein | - |
| GPW72_RS17090 | - | 2531770..2532018 (-) | 249 | WP_000246042.1 | hypothetical protein | - |
| GPW72_RS17095 | - | 2532030..2532803 (-) | 774 | WP_001895334.1 | phage minor head protein | - |
| GPW72_RS17100 | - | 2532796..2534355 (-) | 1560 | WP_000027033.1 | DUF935 domain-containing protein | - |
| GPW72_RS17105 | - | 2534352..2535917 (-) | 1566 | WP_001105344.1 | terminase family protein | - |
| GPW72_RS17110 | - | 2535918..2536484 (-) | 567 | WP_001195537.1 | DUF3486 family protein | - |
| GPW72_RS17115 | - | 2536496..2536786 (-) | 291 | WP_000008606.1 | hypothetical protein | - |
| GPW72_RS17120 | - | 2536795..2537094 (-) | 300 | WP_000362983.1 | DUF2730 family protein | - |
| GPW72_RS17125 | - | 2537094..2537324 (-) | 231 | WP_001281317.1 | TraR/DksA C4-type zinc finger protein | - |
| GPW72_RS17130 | - | 2537321..2537920 (-) | 600 | WP_001120998.1 | hypothetical protein | - |
| GPW72_RS19875 | - | 2537896..2538183 (-) | 288 | WP_000828640.1 | hypothetical protein | - |
| GPW72_RS17135 | - | 2538183..2538740 (-) | 558 | WP_000493682.1 | glycosyl hydrolase 108 family protein | - |
| GPW72_RS17140 | - | 2538825..2539241 (-) | 417 | WP_001029055.1 | Mor transcription activator family protein | - |
| GPW72_RS17145 | - | 2539320..2539766 (-) | 447 | WP_000837433.1 | hypothetical protein | - |
| GPW72_RS17150 | - | 2539756..2540301 (-) | 546 | WP_000040562.1 | regulatory protein GemA | - |
| GPW72_RS17155 | - | 2540314..2540583 (-) | 270 | WP_230078620.1 | hypothetical protein | - |
| GPW72_RS17160 | - | 2540595..2540828 (-) | 234 | WP_000466681.1 | hypothetical protein | - |
| GPW72_RS17170 | - | 2540908..2541438 (-) | 531 | WP_000762331.1 | hypothetical protein | - |
| GPW72_RS17175 | - | 2541435..2541704 (-) | 270 | WP_000856884.1 | DUF3850 domain-containing protein | - |
| GPW72_RS19740 | - | 2541707..2542057 (-) | 351 | WP_001066644.1 | hypothetical protein | - |
| GPW72_RS17185 | - | 2542054..2542251 (-) | 198 | WP_000413231.1 | hypothetical protein | - |
| GPW72_RS17190 | - | 2542235..2542477 (-) | 243 | WP_000551393.1 | hypothetical protein | - |
| GPW72_RS17195 | - | 2542470..2542742 (-) | 273 | WP_000512064.1 | hypothetical protein | - |
| GPW72_RS17200 | - | 2542752..2543366 (-) | 615 | WP_001192102.1 | DUF3164 family protein | - |
| GPW72_RS17205 | - | 2543516..2543890 (-) | 375 | WP_001032752.1 | hypothetical protein | - |
| GPW72_RS17210 | - | 2543900..2544469 (-) | 570 | WP_001216028.1 | hypothetical protein | - |
| GPW72_RS17215 | - | 2544479..2544703 (-) | 225 | WP_000157299.1 | hypothetical protein | - |
| GPW72_RS17220 | - | 2544711..2545655 (-) | 945 | WP_000800334.1 | AAA family ATPase | - |
| GPW72_RS17225 | - | 2545682..2547685 (-) | 2004 | WP_001895336.1 | transposase domain-containing protein | - |
| GPW72_RS17230 | - | 2547697..2547921 (-) | 225 | WP_000373567.1 | helix-turn-helix transcriptional regulator | - |
| GPW72_RS17235 | - | 2548074..2548811 (+) | 738 | WP_000005494.1 | XRE family transcriptional regulator | - |
| GPW72_RS17240 | pilM | 2549080..2549559 (+) | 480 | Protein_2215 | type IV pilus assembly protein PilM | - |
| GPW72_RS17245 | pilN | 2549549..2550133 (+) | 585 | WP_000902745.1 | PilN domain-containing protein | Machinery gene |
| GPW72_RS17250 | pilO | 2550126..2550716 (+) | 591 | WP_000157690.1 | type 4a pilus biogenesis protein PilO | Machinery gene |
| GPW72_RS17255 | pilP | 2550706..2551224 (+) | 519 | WP_000792032.1 | pilus assembly protein PilP | Machinery gene |
| GPW72_RS17260 | pilQ | 2551250..2552965 (+) | 1716 | WP_000788426.1 | type IV pilus secretin PilQ family protein | Machinery gene |
| GPW72_RS17265 | aroK | 2553152..2553676 (+) | 525 | WP_000818616.1 | shikimate kinase AroK | - |
| GPW72_RS17270 | aroB | 2553704..2554789 (+) | 1086 | WP_000439805.1 | 3-dehydroquinate synthase | - |
| GPW72_RS17275 | - | 2554844..2556319 (+) | 1476 | WP_000050198.1 | AAA family ATPase | - |
| GPW72_RS17280 | - | 2556389..2557222 (+) | 834 | WP_000744680.1 | Dam family site-specific DNA-(adenine-N6)-methyltransferase | - |
Sequence
Protein
Download Length: 194 a.a. Molecular weight: 21964.42 Da Isoelectric Point: 9.9503
>NTDB_id=407025 GPW72_RS17245 WP_000902745.1 2549549..2550133(+) (pilN) [Vibrio cholerae strain 3569-08]
MLHKVNLLPWRDARREAHKRRFLGLVTLGVLLAVLMQFAAGEYLGGQMALQQERIGYLQQHIFSLDQQIAKLKIAEEEHK
ALLTRLTVVEQLQQKRNKTTEFMNQMPNLIPEGVYVDKIKMNGHQIEITGISDSTARLATMLDNLEKSDKLTDVEMHEIV
SGNKRFGKQFQSFKVSFQILTPASNPQAGGAHNG
MLHKVNLLPWRDARREAHKRRFLGLVTLGVLLAVLMQFAAGEYLGGQMALQQERIGYLQQHIFSLDQQIAKLKIAEEEHK
ALLTRLTVVEQLQQKRNKTTEFMNQMPNLIPEGVYVDKIKMNGHQIEITGISDSTARLATMLDNLEKSDKLTDVEMHEIV
SGNKRFGKQFQSFKVSFQILTPASNPQAGGAHNG
Nucleotide
Download Length: 585 bp
>NTDB_id=407025 GPW72_RS17245 WP_000902745.1 2549549..2550133(+) (pilN) [Vibrio cholerae strain 3569-08]
ATGTTGCATAAGGTCAACTTACTGCCGTGGCGTGATGCACGGCGTGAAGCACATAAGCGGCGCTTTTTGGGGTTAGTGAC
ACTCGGTGTTTTGCTGGCGGTGTTGATGCAATTTGCAGCAGGCGAATACTTGGGCGGACAAATGGCTTTGCAACAAGAGC
GGATTGGTTATTTGCAACAACATATCTTCTCGCTGGATCAGCAGATCGCTAAGTTGAAGATCGCTGAAGAAGAACATAAG
GCGTTATTGACCCGTTTGACTGTGGTGGAGCAACTGCAGCAAAAGCGCAATAAAACGACTGAGTTTATGAACCAAATGCC
CAACCTGATCCCTGAAGGCGTCTATGTCGACAAGATCAAGATGAATGGCCATCAGATAGAAATAACCGGGATTAGCGATT
CCACCGCTCGCTTGGCAACCATGCTCGATAACTTGGAGAAGTCGGACAAATTAACCGATGTTGAAATGCATGAAATCGTT
TCAGGGAATAAGCGATTTGGTAAGCAATTTCAGAGCTTTAAAGTCTCCTTCCAAATTTTAACCCCAGCCTCTAACCCGCA
AGCGGGAGGTGCACACAATGGCTAG
ATGTTGCATAAGGTCAACTTACTGCCGTGGCGTGATGCACGGCGTGAAGCACATAAGCGGCGCTTTTTGGGGTTAGTGAC
ACTCGGTGTTTTGCTGGCGGTGTTGATGCAATTTGCAGCAGGCGAATACTTGGGCGGACAAATGGCTTTGCAACAAGAGC
GGATTGGTTATTTGCAACAACATATCTTCTCGCTGGATCAGCAGATCGCTAAGTTGAAGATCGCTGAAGAAGAACATAAG
GCGTTATTGACCCGTTTGACTGTGGTGGAGCAACTGCAGCAAAAGCGCAATAAAACGACTGAGTTTATGAACCAAATGCC
CAACCTGATCCCTGAAGGCGTCTATGTCGACAAGATCAAGATGAATGGCCATCAGATAGAAATAACCGGGATTAGCGATT
CCACCGCTCGCTTGGCAACCATGCTCGATAACTTGGAGAAGTCGGACAAATTAACCGATGTTGAAATGCATGAAATCGTT
TCAGGGAATAAGCGATTTGGTAAGCAATTTCAGAGCTTTAAAGTCTCCTTCCAAATTTTAACCCCAGCCTCTAACCCGCA
AGCGGGAGGTGCACACAATGGCTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilN | Vibrio cholerae strain A1552 |
100 |
100 |
1 |
| pilN | Vibrio campbellii strain DS40M4 |
60.452 |
91.237 |
0.552 |