Detailed information    

insolico Bioinformatically predicted

Overview

Name   rcrR   Type   Regulator
Locus tag   GO995_RS05655 Genome accession   NZ_CP046624
Coordinates   1115467..1115907 (-) Length   146 a.a.
NCBI ID   WP_157629109.1    Uniprot ID   -
Organism   Streptococcus ruminicola strain CNU_G3     
Function   regulate competence (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1108344..1129240 1115467..1115907 within 0


Gene organization within MGE regions


Location: 1108344..1129240
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GO995_RS05625 (GO995_05625) - 1108344..1109189 (+) 846 WP_157629105.1 aldo/keto reductase -
  GO995_RS05630 (GO995_05630) - 1109234..1110460 (-) 1227 WP_157629106.1 sensor histidine kinase -
  GO995_RS05635 (GO995_05635) - 1110469..1111149 (-) 681 WP_157629107.1 response regulator transcription factor -
  GO995_RS05640 (GO995_05640) - 1111152..1111787 (-) 636 WP_074799202.1 GTP pyrophosphokinase -
  GO995_RS05645 (GO995_05645) rcrQ 1111887..1113659 (-) 1773 WP_157629108.1 ABC transporter ATP-binding protein Regulator
  GO995_RS05650 (GO995_05650) rcrP 1113649..1115463 (-) 1815 WP_074563880.1 ABC transporter ATP-binding protein Regulator
  GO995_RS05655 (GO995_05655) rcrR 1115467..1115907 (-) 441 WP_157629109.1 MarR family winged helix-turn-helix transcriptional regulator Regulator
  GO995_RS05660 (GO995_05660) - 1116051..1116461 (-) 411 WP_157629110.1 peptide deformylase -
  GO995_RS05665 (GO995_05665) - 1116458..1116967 (-) 510 WP_157629111.1 GNAT family N-acetyltransferase -
  GO995_RS05670 (GO995_05670) gdhA 1117124..1118473 (-) 1350 WP_157629112.1 NADP-specific glutamate dehydrogenase -
  GO995_RS05675 (GO995_05675) - 1118710..1119207 (+) 498 WP_039696754.1 DUF308 domain-containing protein -
  GO995_RS05680 (GO995_05680) queF 1119244..1119735 (-) 492 WP_039696752.1 preQ(1) synthase -
  GO995_RS05685 (GO995_05685) queE 1119884..1120597 (-) 714 WP_157629113.1 7-carboxy-7-deazaguanine synthase QueE -
  GO995_RS05690 (GO995_05690) queD 1120590..1121036 (-) 447 WP_157629114.1 6-carboxytetrahydropterin synthase QueD -
  GO995_RS05695 (GO995_05695) queC 1121036..1121686 (-) 651 WP_157629115.1 7-cyano-7-deazaguanine synthase QueC -
  GO995_RS05700 (GO995_05700) - 1121853..1123622 (-) 1770 WP_157629116.1 ABC transporter ATP-binding protein -
  GO995_RS05705 (GO995_05705) - 1123625..1125364 (-) 1740 WP_157629117.1 ABC transporter ATP-binding protein -
  GO995_RS05710 (GO995_05710) - 1125406..1127274 (-) 1869 WP_074563896.1 ABC-F family ATP-binding cassette domain-containing protein -
  GO995_RS05715 (GO995_05715) - 1127271..1128476 (-) 1206 WP_039696743.1 CCA tRNA nucleotidyltransferase -
  GO995_RS05720 (GO995_05720) dapB 1128473..1129240 (-) 768 WP_074626670.1 4-hydroxy-tetrahydrodipicolinate reductase -

Sequence

Protein


Download         Length: 146 a.a.        Molecular weight: 17122.65 Da        Isoelectric Point: 8.4635

>NTDB_id=406173 GO995_RS05655 WP_157629109.1 1115467..1115907(-) (rcrR) [Streptococcus ruminicola strain CNU_G3]
MRDKDPFSQFRYFINLMENRVHELGEQHGVENLAGPQGFAVLYLRENEDKEVFIKDIERKLKISKSVTSNLIKRMEKNGF
IEVVPSEIDKRYKRVVLTELGKAKSKDIDAFHTAIHKQIFDGISREELEISGRVFDRILKNLENKE

Nucleotide


Download         Length: 441 bp        

>NTDB_id=406173 GO995_RS05655 WP_157629109.1 1115467..1115907(-) (rcrR) [Streptococcus ruminicola strain CNU_G3]
ATGCGAGATAAAGATCCGTTTTCACAATTTAGATACTTTATTAATTTGATGGAGAATCGGGTACATGAGCTCGGTGAGCA
GCATGGTGTTGAAAATCTCGCTGGTCCGCAGGGTTTTGCGGTTCTTTATTTACGTGAAAATGAAGACAAGGAAGTTTTCA
TCAAGGACATTGAACGTAAGCTTAAGATTTCAAAATCTGTGACCAGTAATTTGATTAAGCGAATGGAGAAGAATGGCTTT
ATTGAGGTGGTTCCGTCAGAGATTGATAAGCGTTATAAGCGTGTCGTCTTGACTGAGTTGGGCAAAGCAAAATCCAAAGA
CATCGATGCTTTTCATACTGCTATTCATAAACAAATTTTTGATGGTATTAGCCGTGAAGAACTAGAAATTTCTGGTCGTG
TCTTTGATCGCATTTTGAAAAACTTAGAAAACAAGGAGTAA

Domains

Predicted by InterproScan.

MarR family (MarR_2)

(35-91)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  rcrR Streptococcus mutans UA159

54.545

97.945

0.534

Multiple sequence alignment