Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   GO004_RS18805 Genome accession   NZ_CP046591
Coordinates   3630194..3630334 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain R31     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3625194..3635334
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GO004_RS18775 (GO004_18770) yueI 3625489..3625887 (+) 399 WP_088467369.1 YueI family protein -
  GO004_RS18780 (GO004_18775) pncA 3625984..3626535 (+) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  GO004_RS18785 (GO004_18780) pncB 3626551..3628023 (+) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  GO004_RS18790 (GO004_18785) pdeH 3628160..3629389 (+) 1230 WP_024572553.1 cyclic di-GMP phosphodiesterase -
  GO004_RS18795 (GO004_18790) - 3629365..3629733 (-) 369 WP_014477834.1 hypothetical protein -
  GO004_RS18800 (GO004_18795) - 3629847..3629972 (-) 126 WP_003228793.1 hypothetical protein -
  GO004_RS18805 (GO004_18800) degQ 3630194..3630334 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  GO004_RS18810 (GO004_18805) - 3630519..3631382 (+) 864 WP_043858576.1 polyprenyl synthetase family protein -
  GO004_RS18815 (GO004_18810) comX 3631384..3631605 (+) 222 WP_014480704.1 competence pheromone ComX -
  GO004_RS18820 (GO004_18815) comP 3631621..3633933 (+) 2313 WP_195727738.1 histidine kinase Regulator
  GO004_RS18825 (GO004_18820) comA 3634014..3634658 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  GO004_RS18830 (GO004_18825) yuxO 3634677..3635057 (+) 381 WP_015714624.1 hotdog fold thioesterase -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=405825 GO004_RS18805 WP_003220708.1 3630194..3630334(+) (degQ) [Bacillus subtilis strain R31]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=405825 GO004_RS18805 WP_003220708.1 3630194..3630334(+) (degQ) [Bacillus subtilis strain R31]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment