Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HWI84_RS00200 Genome accession   NZ_CP058250
Coordinates   35009..35122 (+) Length   37 a.a.
NCBI ID   WP_001217868.1    Uniprot ID   -
Organism   Helicobacter pylori strain AL02     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 30009..40122
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HWI84_RS00175 - 30069..32291 (+) 2223 WP_237013144.1 AAA family ATPase -
  HWI84_RS00180 panD 32281..32631 (+) 351 WP_187847004.1 aspartate 1-decarboxylase -
  HWI84_RS00185 - 32642..32935 (+) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  HWI84_RS00190 - 32935..33930 (+) 996 WP_237013583.1 PDZ domain-containing protein -
  HWI84_RS00195 comB6 33938..34993 (+) 1056 WP_237013584.1 P-type conjugative transfer protein TrbL Machinery gene
  HWI84_RS00200 comB7 35009..35122 (+) 114 WP_001217868.1 hypothetical protein Machinery gene
  HWI84_RS00205 comB8 35119..35862 (+) 744 WP_237013145.1 type IV secretion system protein Machinery gene
  HWI84_RS00210 comB9 35862..36821 (+) 960 WP_237013146.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HWI84_RS00215 comB10 36814..37950 (+) 1137 WP_237013147.1 DNA type IV secretion system protein ComB10 Machinery gene
  HWI84_RS00220 - 38017..39432 (+) 1416 WP_237013148.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4323.29 Da        Isoelectric Point: 9.3572

>NTDB_id=404158 HWI84_RS00200 WP_001217868.1 35009..35122(+) (comB7) [Helicobacter pylori strain AL02]
MRIFFVIMGIMLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=404158 HWI84_RS00200 WP_001217868.1 35009..35122(+) (comB7) [Helicobacter pylori strain AL02]
ATGAGAATTTTTTTTGTCATTATGGGAATCATGTTATTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACGCTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

91.892

100

0.919


Multiple sequence alignment