Detailed information    

insolico Bioinformatically predicted

Overview

Name   comE   Type   Machinery gene
Locus tag   GK020_RS13915 Genome accession   NZ_CP046392
Coordinates   2863301..2863738 (-) Length   145 a.a.
NCBI ID   WP_156189562.1    Uniprot ID   -
Organism   Acinetobacter indicus strain WMB-7     
Function   assembly of type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 2863301..2894004 2863301..2863738 within 0


Gene organization within MGE regions


Location: 2863301..2894004
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GK020_RS13915 comE 2863301..2863738 (-) 438 WP_156189562.1 type IV pilin protein Machinery gene
  GK020_RS13920 - 2863749..2867333 (-) 3585 WP_156189563.1 hypothetical protein -
  GK020_RS13925 - 2867345..2868112 (-) 768 WP_016658477.1 hypothetical protein -
  GK020_RS13930 - 2868112..2869209 (-) 1098 WP_156189564.1 PilW family protein -
  GK020_RS13935 pilV 2869211..2869717 (-) 507 WP_171501531.1 type IV pilus modification protein PilV -
  GK020_RS13940 - 2869714..2870154 (-) 441 WP_156189566.1 GspH/FimT family pseudopilin -
  GK020_RS13945 ispH 2870318..2871268 (-) 951 WP_104500732.1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase -
  GK020_RS13950 gmk 2871404..2872027 (+) 624 WP_045795273.1 guanylate kinase -
  GK020_RS13955 rpoZ 2872104..2872385 (+) 282 WP_045795272.1 DNA-directed RNA polymerase subunit omega -
  GK020_RS13960 - 2872609..2874708 (+) 2100 WP_156189567.1 RelA/SpoT family protein -
  GK020_RS13965 - 2874780..2875163 (+) 384 WP_156189568.1 RidA family protein -
  GK020_RS13970 - 2875335..2875529 (+) 195 WP_045795269.1 bacterioferritin-associated ferredoxin -
  GK020_RS13975 bfr 2875756..2876220 (+) 465 WP_005180468.1 bacterioferritin -
  GK020_RS13980 - 2876329..2877969 (-) 1641 WP_156189569.1 PglL family O-oligosaccharyltransferase -
  GK020_RS13985 - 2878287..2879975 (-) 1689 WP_156189570.1 O-antigen ligase family protein -
  GK020_RS13990 pilA 2880055..2880531 (-) 477 WP_156189571.1 pilin Machinery gene
  GK020_RS13995 - 2880810..2881079 (+) 270 WP_156189572.1 DUF1778 domain-containing protein -
  GK020_RS14000 - 2881089..2881388 (+) 300 WP_156189573.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
  GK020_RS14005 - 2881695..2882162 (+) 468 WP_156189574.1 pilin -
  GK020_RS14010 - 2882251..2883156 (+) 906 WP_156189575.1 hypothetical protein -
  GK020_RS14015 - 2883370..2883726 (-) 357 WP_156189576.1 hypothetical protein -
  GK020_RS14020 - 2883730..2885787 (-) 2058 WP_156189577.1 hypothetical protein -
  GK020_RS14025 - 2885784..2887721 (-) 1938 WP_156189578.1 hypothetical protein -
  GK020_RS14030 - 2887718..2889145 (-) 1428 WP_156189579.1 tyrosine-type recombinase/integrase -
  GK020_RS14035 - 2889644..2890027 (+) 384 WP_136143660.1 helix-turn-helix domain-containing protein -
  GK020_RS14040 - 2890043..2890468 (+) 426 WP_017400550.1 hypothetical protein -
  GK020_RS14045 - 2890539..2890748 (-) 210 WP_080592090.1 helix-turn-helix domain-containing protein -
  GK020_RS14050 - 2890909..2891175 (+) 267 WP_004281168.1 hypothetical protein -
  GK020_RS14055 - 2891279..2891899 (+) 621 WP_085064370.1 HAD family hydrolase -
  GK020_RS14060 - 2891931..2892716 (-) 786 WP_156189580.1 hypothetical protein -
  GK020_RS14065 - 2892815..2893174 (-) 360 WP_156189581.1 antitoxin Xre/MbcA/ParS toxin-binding domain-containing protein -
  GK020_RS14075 - 2893492..2894004 (-) 513 WP_156189582.1 hypothetical protein -

Sequence

Protein


Download         Length: 145 a.a.        Molecular weight: 16090.45 Da        Isoelectric Point: 9.9191

>NTDB_id=403812 GK020_RS13915 WP_156189562.1 2863301..2863738(-) (comE) [Acinetobacter indicus strain WMB-7]
MKKNGFTLIELMVVVVIVAIFVAIAIPSYQAYIRRAETSKAQQELKRIATLLERHKARNFSYKGFDFSAQTLSTPRTYSF
ELKDGTHTTKLLNATDAAGHAWVLKATTTDAKNYNYLITSTGIRCKNLTAENISYTGCGTGGEAW

Nucleotide


Download         Length: 438 bp        

>NTDB_id=403812 GK020_RS13915 WP_156189562.1 2863301..2863738(-) (comE) [Acinetobacter indicus strain WMB-7]
ATGAAAAAAAATGGTTTCACCTTAATCGAGCTCATGGTCGTTGTTGTGATTGTTGCGATTTTCGTAGCAATCGCAATTCC
ATCCTATCAAGCTTATATCCGTAGAGCAGAGACATCGAAAGCACAACAAGAGTTGAAGCGCATTGCGACATTACTTGAAC
GGCATAAAGCACGAAATTTTAGTTATAAGGGATTTGATTTTTCTGCTCAAACATTAAGTACCCCTAGAACCTATAGCTTT
GAACTCAAAGATGGTACACATACGACTAAATTATTAAATGCAACAGATGCTGCGGGTCATGCTTGGGTGTTAAAAGCGAC
GACAACAGATGCAAAAAATTATAACTACTTAATTACAAGCACTGGAATTCGGTGTAAAAATTTGACTGCTGAAAACATTA
GTTATACAGGGTGTGGCACTGGAGGGGAGGCATGGTAA

Domains

Predicted by InterproScan.

Type IV minor pilin ComP, DNA uptake sequence receptor (ComP_DUS)

(27-101)

Prokaryotic N-terminal methylation motif (N_methyl)

(2-25)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comE Acinetobacter baylyi ADP1

47.879

100

0.545
  pilY2 Acinetobacter baumannii D1279779

49.333

100

0.51

Multiple sequence alignment