Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | GL188_RS02460 | Genome accession | NZ_CP046359 |
| Coordinates | 478661..478810 (+) | Length | 49 a.a. |
| NCBI ID | WP_001809846.1 | Uniprot ID | Q00MV6 |
| Organism | Streptococcus pneumoniae strain 573 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 473661..483810
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GL188_RS02435 (GL188_02515) | comA/nlmT | 474728..476404 (-) | 1677 | WP_215729172.1 | peptide cleavage/export ABC transporter | Regulator |
| GL188_RS11390 | comA/nlmT | 476298..476885 (-) | 588 | WP_000205166.1 | cysteine peptidase family C39 domain-containing protein | Regulator |
| GL188_RS02445 (GL188_02520) | blpI | 477167..477364 (+) | 198 | WP_001093259.1 | bacteriocin-like peptide BlpI | - |
| GL188_RS02450 (GL188_02525) | blpJ | 477831..478100 (+) | 270 | WP_001093248.1 | bacteriocin-like peptide BlpJ | - |
| GL188_RS02455 (GL188_02530) | blpK | 478169..478417 (+) | 249 | WP_000379965.1 | bacteriocin-like peptide BlpK | - |
| GL188_RS02460 (GL188_02535) | cipB | 478661..478810 (+) | 150 | WP_001809846.1 | bacteriocin-like peptide BlpO | Regulator |
| GL188_RS02465 (GL188_02540) | - | 478914..479033 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| GL188_RS02470 (GL188_02550) | - | 479514..479872 (+) | 359 | Protein_494 | immunity protein | - |
| GL188_RS02475 (GL188_02555) | - | 480501..480884 (+) | 384 | WP_000877381.1 | hypothetical protein | - |
| GL188_RS02480 (GL188_02560) | - | 480936..481625 (+) | 690 | WP_000760532.1 | CPBP family intramembrane glutamic endopeptidase | - |
| GL188_RS02485 (GL188_02565) | blpZ | 481667..481900 (+) | 234 | WP_000276498.1 | immunity protein BlpZ | - |
| GL188_RS02490 (GL188_02570) | - | 482051..482662 (+) | 612 | WP_000394044.1 | CPBP family intramembrane glutamic endopeptidase | - |
| GL188_RS02495 (GL188_02575) | ccrZ | 482823..483617 (+) | 795 | WP_000363002.1 | cell cycle regulator CcrZ | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5149.92 Da Isoelectric Point: 4.0439
>NTDB_id=403320 GL188_RS02460 WP_001809846.1 478661..478810(+) (cipB) [Streptococcus pneumoniae strain 573]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=403320 GL188_RS02460 WP_001809846.1 478661..478810(+) (cipB) [Streptococcus pneumoniae strain 573]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
53.061 |
100 |
0.531 |