Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | GL186_RS02435 | Genome accession | NZ_CP046358 |
| Coordinates | 473654..473803 (+) | Length | 49 a.a. |
| NCBI ID | WP_001809846.1 | Uniprot ID | Q00MV6 |
| Organism | Streptococcus pneumoniae strain 566 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 468654..478803
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GL186_RS02410 (GL186_02505) | comA/nlmT | 469722..471398 (-) | 1677 | WP_215729172.1 | peptide cleavage/export ABC transporter | Regulator |
| GL186_RS11445 | comA/nlmT | 471292..471879 (-) | 588 | WP_000205166.1 | cysteine peptidase family C39 domain-containing protein | Regulator |
| GL186_RS02420 (GL186_02510) | blpI | 472160..472357 (+) | 198 | WP_001093259.1 | bacteriocin-like peptide BlpI | - |
| GL186_RS02425 (GL186_02515) | blpJ | 472824..473093 (+) | 270 | WP_001093248.1 | bacteriocin-like peptide BlpJ | - |
| GL186_RS02430 (GL186_02520) | blpK | 473162..473410 (+) | 249 | WP_000379965.1 | bacteriocin-like peptide BlpK | - |
| GL186_RS02435 (GL186_02525) | cipB | 473654..473803 (+) | 150 | WP_001809846.1 | bacteriocin-like peptide BlpO | Regulator |
| GL186_RS02440 (GL186_02530) | - | 473907..474026 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| GL186_RS02445 (GL186_02540) | - | 474507..474865 (+) | 359 | Protein_491 | immunity protein | - |
| GL186_RS02450 (GL186_02545) | - | 475494..475877 (+) | 384 | WP_000877381.1 | hypothetical protein | - |
| GL186_RS02455 (GL186_02550) | - | 475929..476618 (+) | 690 | WP_000760532.1 | CPBP family intramembrane glutamic endopeptidase | - |
| GL186_RS02460 (GL186_02555) | blpZ | 476660..476893 (+) | 234 | WP_000276498.1 | immunity protein BlpZ | - |
| GL186_RS02465 (GL186_02560) | - | 477044..477655 (+) | 612 | WP_000394044.1 | CPBP family intramembrane glutamic endopeptidase | - |
| GL186_RS02470 (GL186_02565) | ccrZ | 477816..478610 (+) | 795 | WP_000363002.1 | cell cycle regulator CcrZ | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5149.92 Da Isoelectric Point: 4.0439
>NTDB_id=403240 GL186_RS02435 WP_001809846.1 473654..473803(+) (cipB) [Streptococcus pneumoniae strain 566]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=403240 GL186_RS02435 WP_001809846.1 473654..473803(+) (cipB) [Streptococcus pneumoniae strain 566]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
53.061 |
100 |
0.531 |