Detailed information    

insolico Bioinformatically predicted

Overview


Name   cipB   Type   Regulator
Locus tag   GL186_RS02435 Genome accession   NZ_CP046358
Coordinates   473654..473803 (+) Length   49 a.a.
NCBI ID   WP_001809846.1    Uniprot ID   Q00MV6
Organism   Streptococcus pneumoniae strain 566     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context


Location: 468654..478803
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GL186_RS02410 (GL186_02505) comA/nlmT 469722..471398 (-) 1677 WP_215729172.1 peptide cleavage/export ABC transporter Regulator
  GL186_RS11445 comA/nlmT 471292..471879 (-) 588 WP_000205166.1 cysteine peptidase family C39 domain-containing protein Regulator
  GL186_RS02420 (GL186_02510) blpI 472160..472357 (+) 198 WP_001093259.1 bacteriocin-like peptide BlpI -
  GL186_RS02425 (GL186_02515) blpJ 472824..473093 (+) 270 WP_001093248.1 bacteriocin-like peptide BlpJ -
  GL186_RS02430 (GL186_02520) blpK 473162..473410 (+) 249 WP_000379965.1 bacteriocin-like peptide BlpK -
  GL186_RS02435 (GL186_02525) cipB 473654..473803 (+) 150 WP_001809846.1 bacteriocin-like peptide BlpO Regulator
  GL186_RS02440 (GL186_02530) - 473907..474026 (+) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  GL186_RS02445 (GL186_02540) - 474507..474865 (+) 359 Protein_491 immunity protein -
  GL186_RS02450 (GL186_02545) - 475494..475877 (+) 384 WP_000877381.1 hypothetical protein -
  GL186_RS02455 (GL186_02550) - 475929..476618 (+) 690 WP_000760532.1 CPBP family intramembrane glutamic endopeptidase -
  GL186_RS02460 (GL186_02555) blpZ 476660..476893 (+) 234 WP_000276498.1 immunity protein BlpZ -
  GL186_RS02465 (GL186_02560) - 477044..477655 (+) 612 WP_000394044.1 CPBP family intramembrane glutamic endopeptidase -
  GL186_RS02470 (GL186_02565) ccrZ 477816..478610 (+) 795 WP_000363002.1 cell cycle regulator CcrZ -

Sequence


Protein


Download         Length: 49 a.a.        Molecular weight: 5149.92 Da        Isoelectric Point: 4.0439

>NTDB_id=403240 GL186_RS02435 WP_001809846.1 473654..473803(+) (cipB) [Streptococcus pneumoniae strain 566]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=403240 GL186_RS02435 WP_001809846.1 473654..473803(+) (cipB) [Streptococcus pneumoniae strain 566]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q00MV6

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

53.061

100

0.531


Multiple sequence alignment