Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   GL185_RS05025 Genome accession   NZ_CP046357
Coordinates   1010031..1010180 (-) Length   49 a.a.
NCBI ID   WP_001809846.1    Uniprot ID   Q00MV6
Organism   Streptococcus pneumoniae strain 525     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 1010424..1035332 1010031..1010180 flank 244


Gene organization within MGE regions


Location: 1010031..1035332
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GL185_RS05025 (GL185_05080) cipB 1010031..1010180 (-) 150 WP_001809846.1 bacteriocin-like peptide BlpO Regulator
  GL185_RS05030 (GL185_05085) blpK 1010424..1010672 (-) 249 WP_000379965.1 bacteriocin-like peptide BlpK -
  GL185_RS05035 (GL185_05090) blpJ 1010741..1011010 (-) 270 WP_001093248.1 bacteriocin-like peptide BlpJ -
  GL185_RS05040 (GL185_05095) blpI 1011477..1011674 (-) 198 WP_001093259.1 bacteriocin-like peptide BlpI -
  GL185_RS11595 comA/nlmT 1011956..1012543 (+) 588 WP_000205166.1 cysteine peptidase family C39 domain-containing protein Regulator
  GL185_RS05050 (GL185_05100) comA/nlmT 1012470..1014113 (+) 1644 WP_078133412.1 peptide cleavage/export ABC transporter Regulator
  GL185_RS05055 (GL185_05105) - 1014124..1015485 (+) 1362 WP_001069060.1 bacteriocin secretion accessory protein -
  GL185_RS05060 (GL185_05110) blpC 1015542..1015670 (+) 129 WP_000358815.1 quorum-sensing system pheromone BlpC -
  GL185_RS05065 (GL185_05115) - 1015852..1016181 (+) 330 WP_000132572.1 hypothetical protein -
  GL185_RS05070 (GL185_05120) - 1016349..1017398 (-) 1050 WP_000653771.1 ABC transporter permease -
  GL185_RS05075 (GL185_05125) pptA 1017395..1018126 (-) 732 WP_000889921.1 ABC transporter ATP-binding protein Regulator
  GL185_RS05080 (GL185_05130) - 1018194..1018604 (+) 411 WP_001278301.1 HIT family protein -
  GL185_RS05085 (GL185_05135) - 1018614..1018901 (+) 288 WP_000777753.1 hypothetical protein -
  GL185_RS05090 (GL185_05140) - 1019063..1019257 (+) 195 WP_001808905.1 hypothetical protein -
  GL185_RS05095 (GL185_05145) dnaJ 1019591..1020727 (-) 1137 WP_001066295.1 molecular chaperone DnaJ -
  GL185_RS05100 (GL185_05150) - 1021129..1021485 (-) 357 WP_000114422.1 hypothetical protein -
  GL185_RS05105 (GL185_05155) dnaK 1021487..1023310 (-) 1824 WP_000034662.1 molecular chaperone DnaK -
  GL185_RS05110 (GL185_05160) grpE 1023790..1024314 (-) 525 WP_000046031.1 nucleotide exchange factor GrpE -
  GL185_RS05115 (GL185_05165) hrcA 1024341..1025375 (-) 1035 WP_000255779.1 heat-inducible transcriptional repressor HrcA -
  GL185_RS05120 (GL185_05170) - 1025539..1026048 (-) 510 WP_001088689.1 DUF2812 domain-containing protein -
  GL185_RS05125 (GL185_05180) - 1026656..1028989 (+) 2334 WP_024477921.1 DEAD/DEAH box helicase family protein -
  GL185_RS05130 (GL185_05185) - 1029002..1030465 (+) 1464 WP_000029036.1 class I SAM-dependent DNA methyltransferase -
  GL185_RS05135 (GL185_05195) - 1030465..1032015 (+) 1551 WP_000187276.1 restriction endonuclease subunit S -
  GL185_RS05140 (GL185_05200) - 1031963..1032568 (-) 606 WP_001813510.1 restriction endonuclease subunit S -
  GL185_RS05145 (GL185_05205) psrA 1032579..1033376 (-) 798 WP_000651177.1 tyrosine-type DNA invertase PsrA -
  GL185_RS05150 (GL185_05210) - 1033433..1034716 (-) 1284 WP_000229450.1 restriction endonuclease subunit S -
  GL185_RS11110 (GL185_05215) - 1035183..1035332 (-) 150 WP_000410533.1 hypothetical protein -

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5149.92 Da        Isoelectric Point: 4.0439

>NTDB_id=403167 GL185_RS05025 WP_001809846.1 1010031..1010180(-) (cipB) [Streptococcus pneumoniae strain 525]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=403167 GL185_RS05025 WP_001809846.1 1010031..1010180(-) (cipB) [Streptococcus pneumoniae strain 525]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q00MV6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

53.061

100

0.531

Multiple sequence alignment