Detailed information
Overview
| Name | cipB | Type | Regulator |
| Locus tag | GL185_RS05025 | Genome accession | NZ_CP046357 |
| Coordinates | 1010031..1010180 (-) | Length | 49 a.a. |
| NCBI ID | WP_001809846.1 | Uniprot ID | Q00MV6 |
| Organism | Streptococcus pneumoniae strain 525 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 1010424..1035332 | 1010031..1010180 | flank | 244 |
Gene organization within MGE regions
Location: 1010031..1035332
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GL185_RS05025 (GL185_05080) | cipB | 1010031..1010180 (-) | 150 | WP_001809846.1 | bacteriocin-like peptide BlpO | Regulator |
| GL185_RS05030 (GL185_05085) | blpK | 1010424..1010672 (-) | 249 | WP_000379965.1 | bacteriocin-like peptide BlpK | - |
| GL185_RS05035 (GL185_05090) | blpJ | 1010741..1011010 (-) | 270 | WP_001093248.1 | bacteriocin-like peptide BlpJ | - |
| GL185_RS05040 (GL185_05095) | blpI | 1011477..1011674 (-) | 198 | WP_001093259.1 | bacteriocin-like peptide BlpI | - |
| GL185_RS11595 | comA/nlmT | 1011956..1012543 (+) | 588 | WP_000205166.1 | cysteine peptidase family C39 domain-containing protein | Regulator |
| GL185_RS05050 (GL185_05100) | comA/nlmT | 1012470..1014113 (+) | 1644 | WP_078133412.1 | peptide cleavage/export ABC transporter | Regulator |
| GL185_RS05055 (GL185_05105) | - | 1014124..1015485 (+) | 1362 | WP_001069060.1 | bacteriocin secretion accessory protein | - |
| GL185_RS05060 (GL185_05110) | blpC | 1015542..1015670 (+) | 129 | WP_000358815.1 | quorum-sensing system pheromone BlpC | - |
| GL185_RS05065 (GL185_05115) | - | 1015852..1016181 (+) | 330 | WP_000132572.1 | hypothetical protein | - |
| GL185_RS05070 (GL185_05120) | - | 1016349..1017398 (-) | 1050 | WP_000653771.1 | ABC transporter permease | - |
| GL185_RS05075 (GL185_05125) | pptA | 1017395..1018126 (-) | 732 | WP_000889921.1 | ABC transporter ATP-binding protein | Regulator |
| GL185_RS05080 (GL185_05130) | - | 1018194..1018604 (+) | 411 | WP_001278301.1 | HIT family protein | - |
| GL185_RS05085 (GL185_05135) | - | 1018614..1018901 (+) | 288 | WP_000777753.1 | hypothetical protein | - |
| GL185_RS05090 (GL185_05140) | - | 1019063..1019257 (+) | 195 | WP_001808905.1 | hypothetical protein | - |
| GL185_RS05095 (GL185_05145) | dnaJ | 1019591..1020727 (-) | 1137 | WP_001066295.1 | molecular chaperone DnaJ | - |
| GL185_RS05100 (GL185_05150) | - | 1021129..1021485 (-) | 357 | WP_000114422.1 | hypothetical protein | - |
| GL185_RS05105 (GL185_05155) | dnaK | 1021487..1023310 (-) | 1824 | WP_000034662.1 | molecular chaperone DnaK | - |
| GL185_RS05110 (GL185_05160) | grpE | 1023790..1024314 (-) | 525 | WP_000046031.1 | nucleotide exchange factor GrpE | - |
| GL185_RS05115 (GL185_05165) | hrcA | 1024341..1025375 (-) | 1035 | WP_000255779.1 | heat-inducible transcriptional repressor HrcA | - |
| GL185_RS05120 (GL185_05170) | - | 1025539..1026048 (-) | 510 | WP_001088689.1 | DUF2812 domain-containing protein | - |
| GL185_RS05125 (GL185_05180) | - | 1026656..1028989 (+) | 2334 | WP_024477921.1 | DEAD/DEAH box helicase family protein | - |
| GL185_RS05130 (GL185_05185) | - | 1029002..1030465 (+) | 1464 | WP_000029036.1 | class I SAM-dependent DNA methyltransferase | - |
| GL185_RS05135 (GL185_05195) | - | 1030465..1032015 (+) | 1551 | WP_000187276.1 | restriction endonuclease subunit S | - |
| GL185_RS05140 (GL185_05200) | - | 1031963..1032568 (-) | 606 | WP_001813510.1 | restriction endonuclease subunit S | - |
| GL185_RS05145 (GL185_05205) | psrA | 1032579..1033376 (-) | 798 | WP_000651177.1 | tyrosine-type DNA invertase PsrA | - |
| GL185_RS05150 (GL185_05210) | - | 1033433..1034716 (-) | 1284 | WP_000229450.1 | restriction endonuclease subunit S | - |
| GL185_RS11110 (GL185_05215) | - | 1035183..1035332 (-) | 150 | WP_000410533.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5149.92 Da Isoelectric Point: 4.0439
>NTDB_id=403167 GL185_RS05025 WP_001809846.1 1010031..1010180(-) (cipB) [Streptococcus pneumoniae strain 525]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=403167 GL185_RS05025 WP_001809846.1 1010031..1010180(-) (cipB) [Streptococcus pneumoniae strain 525]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
53.061 |
100 |
0.531 |