Detailed information
Overview
| Name | cipB | Type | Regulator |
| Locus tag | GL184_RS08445 | Genome accession | NZ_CP046356 |
| Coordinates | 1651745..1651894 (-) | Length | 49 a.a. |
| NCBI ID | WP_001809846.1 | Uniprot ID | Q00MV6 |
| Organism | Streptococcus pneumoniae strain 521 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 1652138..1677046 | 1651745..1651894 | flank | 244 |
Gene organization within MGE regions
Location: 1651745..1677046
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GL184_RS08445 (GL184_08525) | cipB | 1651745..1651894 (-) | 150 | WP_001809846.1 | bacteriocin-like peptide BlpO | Regulator |
| GL184_RS08450 (GL184_08530) | blpK | 1652138..1652386 (-) | 249 | WP_000379965.1 | bacteriocin-like peptide BlpK | - |
| GL184_RS08455 (GL184_08535) | blpJ | 1652455..1652724 (-) | 270 | WP_001093248.1 | bacteriocin-like peptide BlpJ | - |
| GL184_RS08460 (GL184_08540) | blpI | 1653191..1653388 (-) | 198 | WP_001093259.1 | bacteriocin-like peptide BlpI | - |
| GL184_RS11615 | comA/nlmT | 1653670..1654257 (+) | 588 | WP_000205166.1 | cysteine peptidase family C39 domain-containing protein | Regulator |
| GL184_RS08470 (GL184_08545) | comA/nlmT | 1654184..1655827 (+) | 1644 | WP_078133412.1 | peptide cleavage/export ABC transporter | Regulator |
| GL184_RS08475 (GL184_08550) | - | 1655838..1657199 (+) | 1362 | WP_001069060.1 | bacteriocin secretion accessory protein | - |
| GL184_RS08480 (GL184_08555) | blpC | 1657256..1657384 (+) | 129 | WP_000358815.1 | quorum-sensing system pheromone BlpC | - |
| GL184_RS08485 (GL184_08560) | - | 1657566..1657895 (+) | 330 | WP_000132572.1 | hypothetical protein | - |
| GL184_RS08490 (GL184_08565) | - | 1658063..1659112 (-) | 1050 | WP_000653771.1 | ABC transporter permease | - |
| GL184_RS08495 (GL184_08570) | pptA | 1659109..1659840 (-) | 732 | WP_000889921.1 | ABC transporter ATP-binding protein | Regulator |
| GL184_RS08500 (GL184_08575) | - | 1659908..1660318 (+) | 411 | WP_001278301.1 | HIT family protein | - |
| GL184_RS08505 (GL184_08580) | - | 1660328..1660615 (+) | 288 | WP_000777753.1 | hypothetical protein | - |
| GL184_RS08510 (GL184_08585) | - | 1660777..1660971 (+) | 195 | WP_001808905.1 | hypothetical protein | - |
| GL184_RS08515 (GL184_08590) | dnaJ | 1661305..1662441 (-) | 1137 | WP_001066295.1 | molecular chaperone DnaJ | - |
| GL184_RS08520 (GL184_08595) | - | 1662843..1663199 (-) | 357 | WP_000114422.1 | hypothetical protein | - |
| GL184_RS08525 (GL184_08600) | dnaK | 1663201..1665024 (-) | 1824 | WP_000034662.1 | molecular chaperone DnaK | - |
| GL184_RS08530 (GL184_08605) | grpE | 1665504..1666028 (-) | 525 | WP_000046031.1 | nucleotide exchange factor GrpE | - |
| GL184_RS08535 (GL184_08610) | hrcA | 1666055..1667089 (-) | 1035 | WP_000255779.1 | heat-inducible transcriptional repressor HrcA | - |
| GL184_RS08540 (GL184_08615) | - | 1667253..1667762 (-) | 510 | WP_001088689.1 | DUF2812 domain-containing protein | - |
| GL184_RS08545 (GL184_08625) | hsdR | 1668370..1670703 (+) | 2334 | WP_024477921.1 | EcoAI/FtnUII family type I restriction enzme subunit R | - |
| GL184_RS08550 (GL184_08630) | - | 1670716..1672179 (+) | 1464 | WP_000029036.1 | HsdM family class I SAM-dependent methyltransferase | - |
| GL184_RS08555 (GL184_08635) | - | 1672179..1673747 (+) | 1569 | WP_000187242.1 | restriction endonuclease subunit S | - |
| GL184_RS08560 (GL184_08640) | - | 1673695..1674300 (-) | 606 | WP_001813510.1 | restriction endonuclease subunit S | - |
| GL184_RS08565 (GL184_08645) | psrA | 1674311..1675108 (-) | 798 | WP_000651177.1 | tyrosine-type DNA invertase PsrA | - |
| GL184_RS08570 (GL184_08650) | - | 1675165..1676445 (-) | 1281 | WP_001220759.1 | restriction endonuclease subunit S | - |
| GL184_RS11200 (GL184_08655) | - | 1676897..1677046 (-) | 150 | WP_000410533.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5149.92 Da Isoelectric Point: 4.0439
>NTDB_id=403134 GL184_RS08445 WP_001809846.1 1651745..1651894(-) (cipB) [Streptococcus pneumoniae strain 521]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=403134 GL184_RS08445 WP_001809846.1 1651745..1651894(-) (cipB) [Streptococcus pneumoniae strain 521]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
53.061 |
100 |
0.531 |