Detailed information    

insolico Bioinformatically predicted

Overview


Name   cipB   Type   Regulator
Locus tag   GL184_RS08445 Genome accession   NZ_CP046356
Coordinates   1651745..1651894 (-) Length   49 a.a.
NCBI ID   WP_001809846.1    Uniprot ID   Q00MV6
Organism   Streptococcus pneumoniae strain 521     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 1652138..1677046 1651745..1651894 flank 244


Gene organization within MGE regions


Location: 1651745..1677046
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GL184_RS08445 (GL184_08525) cipB 1651745..1651894 (-) 150 WP_001809846.1 bacteriocin-like peptide BlpO Regulator
  GL184_RS08450 (GL184_08530) blpK 1652138..1652386 (-) 249 WP_000379965.1 bacteriocin-like peptide BlpK -
  GL184_RS08455 (GL184_08535) blpJ 1652455..1652724 (-) 270 WP_001093248.1 bacteriocin-like peptide BlpJ -
  GL184_RS08460 (GL184_08540) blpI 1653191..1653388 (-) 198 WP_001093259.1 bacteriocin-like peptide BlpI -
  GL184_RS11615 comA/nlmT 1653670..1654257 (+) 588 WP_000205166.1 cysteine peptidase family C39 domain-containing protein Regulator
  GL184_RS08470 (GL184_08545) comA/nlmT 1654184..1655827 (+) 1644 WP_078133412.1 peptide cleavage/export ABC transporter Regulator
  GL184_RS08475 (GL184_08550) - 1655838..1657199 (+) 1362 WP_001069060.1 bacteriocin secretion accessory protein -
  GL184_RS08480 (GL184_08555) blpC 1657256..1657384 (+) 129 WP_000358815.1 quorum-sensing system pheromone BlpC -
  GL184_RS08485 (GL184_08560) - 1657566..1657895 (+) 330 WP_000132572.1 hypothetical protein -
  GL184_RS08490 (GL184_08565) - 1658063..1659112 (-) 1050 WP_000653771.1 ABC transporter permease -
  GL184_RS08495 (GL184_08570) pptA 1659109..1659840 (-) 732 WP_000889921.1 ABC transporter ATP-binding protein Regulator
  GL184_RS08500 (GL184_08575) - 1659908..1660318 (+) 411 WP_001278301.1 HIT family protein -
  GL184_RS08505 (GL184_08580) - 1660328..1660615 (+) 288 WP_000777753.1 hypothetical protein -
  GL184_RS08510 (GL184_08585) - 1660777..1660971 (+) 195 WP_001808905.1 hypothetical protein -
  GL184_RS08515 (GL184_08590) dnaJ 1661305..1662441 (-) 1137 WP_001066295.1 molecular chaperone DnaJ -
  GL184_RS08520 (GL184_08595) - 1662843..1663199 (-) 357 WP_000114422.1 hypothetical protein -
  GL184_RS08525 (GL184_08600) dnaK 1663201..1665024 (-) 1824 WP_000034662.1 molecular chaperone DnaK -
  GL184_RS08530 (GL184_08605) grpE 1665504..1666028 (-) 525 WP_000046031.1 nucleotide exchange factor GrpE -
  GL184_RS08535 (GL184_08610) hrcA 1666055..1667089 (-) 1035 WP_000255779.1 heat-inducible transcriptional repressor HrcA -
  GL184_RS08540 (GL184_08615) - 1667253..1667762 (-) 510 WP_001088689.1 DUF2812 domain-containing protein -
  GL184_RS08545 (GL184_08625) hsdR 1668370..1670703 (+) 2334 WP_024477921.1 EcoAI/FtnUII family type I restriction enzme subunit R -
  GL184_RS08550 (GL184_08630) - 1670716..1672179 (+) 1464 WP_000029036.1 HsdM family class I SAM-dependent methyltransferase -
  GL184_RS08555 (GL184_08635) - 1672179..1673747 (+) 1569 WP_000187242.1 restriction endonuclease subunit S -
  GL184_RS08560 (GL184_08640) - 1673695..1674300 (-) 606 WP_001813510.1 restriction endonuclease subunit S -
  GL184_RS08565 (GL184_08645) psrA 1674311..1675108 (-) 798 WP_000651177.1 tyrosine-type DNA invertase PsrA -
  GL184_RS08570 (GL184_08650) - 1675165..1676445 (-) 1281 WP_001220759.1 restriction endonuclease subunit S -
  GL184_RS11200 (GL184_08655) - 1676897..1677046 (-) 150 WP_000410533.1 hypothetical protein -

Sequence


Protein


Download         Length: 49 a.a.        Molecular weight: 5149.92 Da        Isoelectric Point: 4.0439

>NTDB_id=403134 GL184_RS08445 WP_001809846.1 1651745..1651894(-) (cipB) [Streptococcus pneumoniae strain 521]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=403134 GL184_RS08445 WP_001809846.1 1651745..1651894(-) (cipB) [Streptococcus pneumoniae strain 521]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q00MV6

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

53.061

100

0.531


Multiple sequence alignment