Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   GL184_RS08445 Genome accession   NZ_CP046356
Coordinates   1651745..1651894 (-) Length   49 a.a.
NCBI ID   WP_001809846.1    Uniprot ID   Q00MV6
Organism   Streptococcus pneumoniae strain 521     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 1646745..1656894
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GL184_RS08410 (GL184_08485) ccrZ 1646938..1647732 (-) 795 WP_000363002.1 cell cycle regulator CcrZ -
  GL184_RS08415 (GL184_08490) - 1647893..1648504 (-) 612 WP_000394044.1 CPBP family intramembrane glutamic endopeptidase -
  GL184_RS08420 (GL184_08495) blpZ 1648655..1648888 (-) 234 WP_000276498.1 immunity protein BlpZ -
  GL184_RS08425 (GL184_08500) - 1648930..1649619 (-) 690 WP_000760532.1 CPBP family intramembrane glutamic endopeptidase -
  GL184_RS08430 (GL184_08505) - 1649671..1650054 (-) 384 WP_000877381.1 hypothetical protein -
  GL184_RS08435 (GL184_08510) - 1650683..1651041 (-) 359 Protein_1634 immunity protein -
  GL184_RS08440 (GL184_08520) - 1651522..1651641 (-) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  GL184_RS11660 - 1651644..1651709 (-) 66 Protein_1636 ComC/BlpC family peptide pheromone/bacteriocin -
  GL184_RS08445 (GL184_08525) cipB 1651745..1651894 (-) 150 WP_001809846.1 bacteriocin-like peptide BlpO Regulator
  GL184_RS08450 (GL184_08530) blpK 1652138..1652386 (-) 249 WP_000379965.1 bacteriocin-like peptide BlpK -
  GL184_RS08455 (GL184_08535) blpJ 1652455..1652724 (-) 270 WP_001093248.1 bacteriocin-like peptide BlpJ -
  GL184_RS08460 (GL184_08540) blpI 1653191..1653388 (-) 198 WP_001093259.1 bacteriocin-like peptide BlpI -
  GL184_RS11615 comA/nlmT 1653670..1654257 (+) 588 WP_000205166.1 cysteine peptidase family C39 domain-containing protein Regulator
  GL184_RS08470 (GL184_08545) comA/nlmT 1654184..1655827 (+) 1644 WP_078133412.1 peptide cleavage/export ABC transporter Regulator

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5149.92 Da        Isoelectric Point: 4.0439

>NTDB_id=403134 GL184_RS08445 WP_001809846.1 1651745..1651894(-) (cipB) [Streptococcus pneumoniae strain 521]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=403134 GL184_RS08445 WP_001809846.1 1651745..1651894(-) (cipB) [Streptococcus pneumoniae strain 521]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterProScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

53.061

100

0.531

Multiple sequence alignment