Detailed information    

insolico Bioinformatically predicted

Overview

Name   comK/comK1   Type   Regulator
Locus tag   FOC54_RS01960 Genome accession   NZ_CP046306
Coordinates   345653..346237 (+) Length   194 a.a.
NCBI ID   WP_143129548.1    Uniprot ID   -
Organism   Staphylococcus hominis strain FDAARGOS_746     
Function   promote expression of competence genes (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 344061..391181 345653..346237 within 0


Gene organization within MGE regions


Location: 344061..391181
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FOC54_RS01945 (FOC54_01945) - 344061..344615 (-) 555 WP_155974880.1 GNAT family N-acetyltransferase -
  FOC54_RS01950 (FOC54_01950) - 344759..344971 (+) 213 WP_155974881.1 TM2 domain-containing protein -
  FOC54_RS11995 - 345061..345159 (+) 99 WP_017175792.1 SAR1012 family small protein -
  FOC54_RS01955 (FOC54_01955) - 345227..345445 (-) 219 WP_070718559.1 IDEAL domain-containing protein -
  FOC54_RS01960 (FOC54_01960) comK/comK1 345653..346237 (+) 585 WP_143129548.1 competence protein ComK Regulator
  FOC54_RS01975 (FOC54_01975) - 346735..346947 (-) 213 WP_155974882.1 hypothetical protein -
  FOC54_RS01980 (FOC54_01980) - 347076..348812 (-) 1737 WP_155974883.1 N-acetylmuramoyl-L-alanine amidase -
  FOC54_RS01985 (FOC54_01985) - 348825..349112 (-) 288 WP_155974884.1 phage holin -
  FOC54_RS01990 (FOC54_01990) - 349168..349695 (-) 528 WP_231117759.1 hypothetical protein -
  FOC54_RS01995 (FOC54_01995) - 349695..350201 (-) 507 WP_155974886.1 hypothetical protein -
  FOC54_RS02000 (FOC54_02000) - 350243..351271 (-) 1029 WP_155974887.1 hypothetical protein -
  FOC54_RS12080 - 351274..352644 (-) 1371 WP_269203704.1 BppU family phage baseplate upper protein -
  FOC54_RS02010 (FOC54_02010) - 352697..354634 (-) 1938 WP_155974888.1 glucosaminidase domain-containing protein -
  FOC54_RS02015 (FOC54_02015) - 354684..355175 (-) 492 WP_002500204.1 holin family protein -
  FOC54_RS02020 (FOC54_02020) - 355197..356393 (-) 1197 WP_155974889.1 BppU family phage baseplate upper protein -
  FOC54_RS02025 (FOC54_02025) - 356406..358280 (-) 1875 WP_155974890.1 M14 family metallopeptidase -
  FOC54_RS02030 (FOC54_02030) - 358291..359541 (-) 1251 WP_145443714.1 phage tail protein -
  FOC54_RS02035 (FOC54_02035) - 359551..360507 (-) 957 WP_145443716.1 phage tail domain-containing protein -
  FOC54_RS02040 (FOC54_02040) - 360520..363912 (-) 3393 WP_155974891.1 hypothetical protein -
  FOC54_RS02045 (FOC54_02045) - 363912..364277 (-) 366 WP_017175548.1 hypothetical protein -
  FOC54_RS02050 (FOC54_02050) - 364307..364678 (-) 372 WP_016064899.1 tail assembly chaperone -
  FOC54_RS02055 (FOC54_02055) - 364747..365349 (-) 603 WP_231117760.1 phage major tail protein, TP901-1 family -
  FOC54_RS02060 (FOC54_02060) - 365361..365756 (-) 396 WP_100442567.1 hypothetical protein -
  FOC54_RS02065 (FOC54_02065) - 365767..366117 (-) 351 WP_016064896.1 HK97-gp10 family putative phage morphogenesis protein -
  FOC54_RS02070 (FOC54_02070) - 366107..366421 (-) 315 WP_016064895.1 hypothetical protein -
  FOC54_RS02075 (FOC54_02075) - 366418..366753 (-) 336 WP_155974892.1 phage head-tail connector protein -
  FOC54_RS02080 (FOC54_02080) - 366781..367692 (-) 912 WP_016064893.1 hypothetical protein -
  FOC54_RS02085 (FOC54_02085) - 367708..368319 (-) 612 WP_155974893.1 DUF4355 domain-containing protein -
  FOC54_RS11860 - 368455..368604 (-) 150 WP_017175556.1 hypothetical protein -
  FOC54_RS02090 (FOC54_02090) - 368597..369634 (-) 1038 WP_155974894.1 minor capsid protein -
  FOC54_RS02095 (FOC54_02095) - 369618..371069 (-) 1452 WP_155974895.1 phage portal protein -
  FOC54_RS02100 (FOC54_02100) - 371070..372359 (-) 1290 WP_155974896.1 PBSX family phage terminase large subunit -
  FOC54_RS02105 (FOC54_02105) - 372362..372787 (-) 426 WP_145447465.1 terminase small subunit -
  FOC54_RS02110 (FOC54_02110) - 373027..373440 (-) 414 WP_155974897.1 transcriptional regulator -
  FOC54_RS02115 (FOC54_02115) - 373444..373941 (-) 498 WP_155974898.1 Holliday junction resolvase RecU -
  FOC54_RS02120 (FOC54_02120) rinB 374210..374380 (-) 171 WP_231117761.1 transcriptional activator RinB -
  FOC54_RS02125 (FOC54_02125) - 374393..374596 (-) 204 WP_155974899.1 hypothetical protein -
  FOC54_RS02130 (FOC54_02130) - 374636..375181 (-) 546 WP_155974900.1 dUTPase -
  FOC54_RS02135 (FOC54_02135) - 375181..375402 (-) 222 WP_155974901.1 hypothetical protein -
  FOC54_RS02140 (FOC54_02140) - 375386..375601 (-) 216 WP_061815657.1 hypothetical protein -
  FOC54_RS12085 - 375594..375722 (-) 129 WP_269203705.1 hypothetical protein -
  FOC54_RS02145 (FOC54_02145) - 375723..375971 (-) 249 WP_155974902.1 hypothetical protein -
  FOC54_RS02150 (FOC54_02150) - 375964..376860 (-) 897 WP_155974903.1 DnaD domain-containing protein -
  FOC54_RS02155 (FOC54_02155) - 376892..377434 (-) 543 WP_155974904.1 NUMOD4 motif-containing HNH endonuclease -
  FOC54_RS02160 (FOC54_02160) ssbA 377448..377906 (-) 459 WP_155974905.1 single-stranded DNA-binding protein Machinery gene
  FOC54_RS12000 - 377918..378256 (-) 339 WP_231117762.1 hypothetical protein -
  FOC54_RS12005 - 378273..378512 (-) 240 WP_231117763.1 hypothetical protein -
  FOC54_RS02170 (FOC54_02170) - 378509..379132 (-) 624 WP_331251440.1 MBL fold metallo-hydrolase -
  FOC54_RS02175 (FOC54_02175) - 379213..380148 (-) 936 WP_155974907.1 recombinase RecT -
  FOC54_RS02180 (FOC54_02180) - 380150..382099 (-) 1950 WP_155974908.1 AAA family ATPase -
  FOC54_RS11865 - 382184..382354 (-) 171 WP_196774448.1 hypothetical protein -
  FOC54_RS02185 (FOC54_02185) - 382374..382688 (-) 315 WP_155974909.1 DUF771 domain-containing protein -
  FOC54_RS02190 (FOC54_02190) - 382736..382927 (+) 192 WP_155974910.1 hypothetical protein -
  FOC54_RS12135 - 382941..383012 (-) 72 Protein_385 hypothetical protein -
  FOC54_RS02195 (FOC54_02195) - 383076..383843 (-) 768 WP_131566283.1 DUF6551 family protein -
  FOC54_RS02200 (FOC54_02200) - 383843..384766 (-) 924 WP_196774449.1 ParB N-terminal domain-containing protein -
  FOC54_RS02205 (FOC54_02205) - 384905..385150 (-) 246 WP_155974912.1 helix-turn-helix domain-containing protein -
  FOC54_RS02210 (FOC54_02210) - 385327..385662 (+) 336 WP_131566277.1 helix-turn-helix domain-containing protein -
  FOC54_RS02215 (FOC54_02215) - 385675..386139 (+) 465 WP_155974913.1 ImmA/IrrE family metallo-endopeptidase -
  FOC54_RS02220 (FOC54_02220) - 386155..386832 (+) 678 WP_155974914.1 hypothetical protein -
  FOC54_RS02225 (FOC54_02225) - 386880..387932 (+) 1053 WP_155974915.1 tyrosine-type recombinase/integrase -
  FOC54_RS02230 (FOC54_02230) - 388227..388847 (-) 621 WP_155974916.1 hypothetical protein -
  FOC54_RS02235 (FOC54_02235) - 388935..390176 (-) 1242 WP_155974917.1 Fic family protein -

Sequence

Protein


Download         Length: 194 a.a.        Molecular weight: 22933.19 Da        Isoelectric Point: 9.5206

>NTDB_id=402464 FOC54_RS01960 WP_143129548.1 345653..346237(+) (comK/comK1) [Staphylococcus hominis strain FDAARGOS_746]
MTQFNKSPNTIYVIRKGDMVIRPTFDDHQQPNGSEILKFDTSREISPFKTQKIIERSCRFYGNNYLSKKAETQRIAGITS
KPPILLTPLFPTYFFPTHSDRLEENIWINMHYISDIKPLKNRKSKIVFANQESLTLNVSFHSLWHQYSNSIFYYYMIDKQ
ARMKSNNPDMPIDYEKTSLNIFEALSHYSLLEDK

Nucleotide


Download         Length: 585 bp        

>NTDB_id=402464 FOC54_RS01960 WP_143129548.1 345653..346237(+) (comK/comK1) [Staphylococcus hominis strain FDAARGOS_746]
ATGACTCAGTTCAATAAATCTCCTAATACGATTTATGTCATACGTAAAGGTGATATGGTGATTAGACCTACCTTTGATGA
TCATCAACAACCGAACGGCTCAGAAATCCTCAAATTCGATACCTCACGAGAAATAAGCCCTTTTAAAACTCAAAAAATTA
TTGAACGATCTTGTAGATTTTATGGCAATAACTACTTAAGCAAGAAAGCTGAAACTCAACGCATTGCTGGAATAACTAGT
AAACCTCCCATCCTTCTCACACCATTGTTTCCAACTTACTTTTTCCCAACACATTCAGACCGTTTAGAAGAAAATATATG
GATTAATATGCATTATATTTCTGATATTAAGCCATTAAAAAACAGAAAGAGTAAAATTGTCTTTGCTAATCAAGAATCAC
TAACATTAAATGTATCTTTTCATAGTTTATGGCATCAATATTCTAATTCTATTTTCTATTACTATATGATTGATAAACAA
GCAAGAATGAAGTCTAATAATCCAGATATGCCAATCGATTATGAAAAAACATCTTTAAATATCTTTGAGGCACTTTCACA
CTATTCTTTATTAGAAGATAAATAG

Domains

Predicted by InterproScan.

ComK protein (ComK)

(11-161)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comK/comK1 Staphylococcus aureus MW2

75

94.845

0.711
  comK/comK1 Staphylococcus aureus N315

75

94.845

0.711

Multiple sequence alignment