Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   GKO36_RS13190 Genome accession   NZ_CP046145
Coordinates   2684068..2684505 (-) Length   145 a.a.
NCBI ID   WP_007612572.1    Uniprot ID   -
Organism   Bacillus velezensis strain PEBA20     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2679068..2689505
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GKO36_RS13140 (GKO36_13050) sinI 2679451..2679624 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  GKO36_RS13145 (GKO36_13055) sinR 2679658..2679993 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  GKO36_RS13150 (GKO36_13060) - 2680041..2680826 (-) 786 WP_007408329.1 TasA family protein -
  GKO36_RS13155 (GKO36_13065) - 2680891..2681475 (-) 585 WP_014418370.1 signal peptidase I -
  GKO36_RS13160 (GKO36_13070) tapA 2681447..2682118 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  GKO36_RS13165 (GKO36_13075) - 2682377..2682706 (+) 330 WP_014418372.1 DUF3889 domain-containing protein -
  GKO36_RS13170 (GKO36_13080) - 2682747..2682926 (-) 180 WP_003153093.1 YqzE family protein -
  GKO36_RS13175 (GKO36_13085) comGG 2682983..2683360 (-) 378 WP_014418373.1 competence type IV pilus minor pilin ComGG Machinery gene
  GKO36_RS13180 (GKO36_13090) comGF 2683361..2683861 (-) 501 WP_014418374.1 competence type IV pilus minor pilin ComGF -
  GKO36_RS13185 (GKO36_13095) comGE 2683770..2684084 (-) 315 WP_032863566.1 competence type IV pilus minor pilin ComGE Machinery gene
  GKO36_RS13190 (GKO36_13100) comGD 2684068..2684505 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  GKO36_RS13195 (GKO36_13105) comGC 2684495..2684803 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  GKO36_RS13200 (GKO36_13110) comGB 2684808..2685845 (-) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  GKO36_RS13205 (GKO36_13115) comGA 2685832..2686902 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  GKO36_RS13210 (GKO36_13120) - 2687095..2688045 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -
  GKO36_RS13215 (GKO36_13125) - 2688190..2689491 (+) 1302 WP_029973873.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16254.76 Da        Isoelectric Point: 10.1850

>NTDB_id=401635 GKO36_RS13190 WP_007612572.1 2684068..2684505(-) (comGD) [Bacillus velezensis strain PEBA20]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=401635 GKO36_RS13190 WP_007612572.1 2684068..2684505(-) (comGD) [Bacillus velezensis strain PEBA20]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTACTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCACATTACGCTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATACAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

55.479

100

0.559


Multiple sequence alignment