Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   GKO36_RS13140 Genome accession   NZ_CP046145
Coordinates   2679451..2679624 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain PEBA20     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2674451..2684624
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GKO36_RS13125 (GKO36_13035) gcvT 2675264..2676364 (-) 1101 WP_014418366.1 glycine cleavage system aminomethyltransferase GcvT -
  GKO36_RS13130 (GKO36_13040) - 2676788..2678458 (+) 1671 WP_021494309.1 SNF2-related protein -
  GKO36_RS13135 (GKO36_13045) - 2678480..2679274 (+) 795 WP_014418368.1 YqhG family protein -
  GKO36_RS13140 (GKO36_13050) sinI 2679451..2679624 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  GKO36_RS13145 (GKO36_13055) sinR 2679658..2679993 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  GKO36_RS13150 (GKO36_13060) - 2680041..2680826 (-) 786 WP_007408329.1 TasA family protein -
  GKO36_RS13155 (GKO36_13065) - 2680891..2681475 (-) 585 WP_014418370.1 signal peptidase I -
  GKO36_RS13160 (GKO36_13070) tapA 2681447..2682118 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  GKO36_RS13165 (GKO36_13075) - 2682377..2682706 (+) 330 WP_014418372.1 DUF3889 domain-containing protein -
  GKO36_RS13170 (GKO36_13080) - 2682747..2682926 (-) 180 WP_003153093.1 YqzE family protein -
  GKO36_RS13175 (GKO36_13085) comGG 2682983..2683360 (-) 378 WP_014418373.1 competence type IV pilus minor pilin ComGG Machinery gene
  GKO36_RS13180 (GKO36_13090) comGF 2683361..2683861 (-) 501 WP_014418374.1 competence type IV pilus minor pilin ComGF -
  GKO36_RS13185 (GKO36_13095) comGE 2683770..2684084 (-) 315 WP_032863566.1 competence type IV pilus minor pilin ComGE Machinery gene
  GKO36_RS13190 (GKO36_13100) comGD 2684068..2684505 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=401631 GKO36_RS13140 WP_014418369.1 2679451..2679624(+) (sinI) [Bacillus velezensis strain PEBA20]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=401631 GKO36_RS13140 WP_014418369.1 2679451..2679624(+) (sinI) [Bacillus velezensis strain PEBA20]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719


Multiple sequence alignment