Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | GKO36_RS13140 | Genome accession | NZ_CP046145 |
| Coordinates | 2679451..2679624 (+) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | I2C7P2 |
| Organism | Bacillus velezensis strain PEBA20 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2674451..2684624
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GKO36_RS13125 (GKO36_13035) | gcvT | 2675264..2676364 (-) | 1101 | WP_014418366.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| GKO36_RS13130 (GKO36_13040) | - | 2676788..2678458 (+) | 1671 | WP_021494309.1 | SNF2-related protein | - |
| GKO36_RS13135 (GKO36_13045) | - | 2678480..2679274 (+) | 795 | WP_014418368.1 | YqhG family protein | - |
| GKO36_RS13140 (GKO36_13050) | sinI | 2679451..2679624 (+) | 174 | WP_014418369.1 | anti-repressor SinI family protein | Regulator |
| GKO36_RS13145 (GKO36_13055) | sinR | 2679658..2679993 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| GKO36_RS13150 (GKO36_13060) | - | 2680041..2680826 (-) | 786 | WP_007408329.1 | TasA family protein | - |
| GKO36_RS13155 (GKO36_13065) | - | 2680891..2681475 (-) | 585 | WP_014418370.1 | signal peptidase I | - |
| GKO36_RS13160 (GKO36_13070) | tapA | 2681447..2682118 (-) | 672 | WP_014418371.1 | amyloid fiber anchoring/assembly protein TapA | - |
| GKO36_RS13165 (GKO36_13075) | - | 2682377..2682706 (+) | 330 | WP_014418372.1 | DUF3889 domain-containing protein | - |
| GKO36_RS13170 (GKO36_13080) | - | 2682747..2682926 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| GKO36_RS13175 (GKO36_13085) | comGG | 2682983..2683360 (-) | 378 | WP_014418373.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| GKO36_RS13180 (GKO36_13090) | comGF | 2683361..2683861 (-) | 501 | WP_014418374.1 | competence type IV pilus minor pilin ComGF | - |
| GKO36_RS13185 (GKO36_13095) | comGE | 2683770..2684084 (-) | 315 | WP_032863566.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| GKO36_RS13190 (GKO36_13100) | comGD | 2684068..2684505 (-) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=401631 GKO36_RS13140 WP_014418369.1 2679451..2679624(+) (sinI) [Bacillus velezensis strain PEBA20]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=401631 GKO36_RS13140 WP_014418369.1 2679451..2679624(+) (sinI) [Bacillus velezensis strain PEBA20]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |