Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | GJE16_RS02495 | Genome accession | NZ_CP045931 |
| Coordinates | 477861..478010 (+) | Length | 49 a.a. |
| NCBI ID | WP_001809846.1 | Uniprot ID | Q00MV6 |
| Organism | Streptococcus pneumoniae strain AUSMDU00010538 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 472861..483010
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GJE16_RS02475 (GJE16_02475) | comA/nlmT | 473928..475604 (-) | 1677 | WP_196300924.1 | peptide cleavage/export ABC transporter | Regulator |
| GJE16_RS11285 | comA/nlmT | 475498..476085 (-) | 588 | WP_000205166.1 | cysteine peptidase family C39 domain-containing protein | Regulator |
| GJE16_RS02480 (GJE16_02480) | blpI | 476367..476564 (+) | 198 | WP_001093259.1 | bacteriocin-like peptide BlpI | - |
| GJE16_RS02485 (GJE16_02485) | blpJ | 477031..477300 (+) | 270 | WP_001093248.1 | bacteriocin-like peptide BlpJ | - |
| GJE16_RS02490 (GJE16_02490) | blpK | 477369..477617 (+) | 249 | WP_047475057.1 | bacteriocin-like peptide BlpK | - |
| GJE16_RS02495 (GJE16_02495) | cipB | 477861..478010 (+) | 150 | WP_001809846.1 | bacteriocin-like peptide BlpO | Regulator |
| GJE16_RS11400 | - | 478046..478111 (+) | 66 | Protein_491 | ComC/BlpC family peptide pheromone/bacteriocin | - |
| GJE16_RS02500 (GJE16_02500) | - | 478114..478233 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| GJE16_RS02510 (GJE16_02510) | - | 478714..479072 (+) | 359 | Protein_493 | immunity protein | - |
| GJE16_RS02515 (GJE16_02515) | - | 479701..480084 (+) | 384 | WP_000877381.1 | hypothetical protein | - |
| GJE16_RS02520 (GJE16_02520) | - | 480136..480825 (+) | 690 | WP_000760532.1 | CPBP family intramembrane glutamic endopeptidase | - |
| GJE16_RS02525 (GJE16_02525) | blpZ | 480867..481100 (+) | 234 | WP_000276498.1 | immunity protein BlpZ | - |
| GJE16_RS02530 (GJE16_02530) | - | 481251..481862 (+) | 612 | WP_000394044.1 | CPBP family intramembrane glutamic endopeptidase | - |
| GJE16_RS02535 (GJE16_02535) | ccrZ | 482023..482817 (+) | 795 | WP_000363002.1 | cell cycle regulator CcrZ | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5149.92 Da Isoelectric Point: 4.0439
>NTDB_id=399396 GJE16_RS02495 WP_001809846.1 477861..478010(+) (cipB) [Streptococcus pneumoniae strain AUSMDU00010538]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=399396 GJE16_RS02495 WP_001809846.1 477861..478010(+) (cipB) [Streptococcus pneumoniae strain AUSMDU00010538]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
53.061 |
100 |
0.531 |