Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGC   Type   Machinery gene
Locus tag   GI367_RS07780 Genome accession   NZ_CP045926
Coordinates   1687350..1687616 (-) Length   88 a.a.
NCBI ID   WP_042635730.1    Uniprot ID   -
Organism   Bacillus velezensis strain AL7     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1682350..1692616
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GI367_RS07730 (GI367_07730) sinR 1682513..1682848 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  GI367_RS07735 (GI367_07735) tasA 1682896..1683681 (-) 786 WP_007612547.1 biofilm matrix protein TasA -
  GI367_RS07740 (GI367_07740) sipW 1683746..1684330 (-) 585 WP_007612550.1 signal peptidase I SipW -
  GI367_RS07745 (GI367_07745) tapA 1684302..1684973 (-) 672 WP_029326077.1 amyloid fiber anchoring/assembly protein TapA -
  GI367_RS07750 (GI367_07750) - 1685232..1685561 (+) 330 WP_007612559.1 DUF3889 domain-containing protein -
  GI367_RS07755 (GI367_07755) - 1685602..1685781 (-) 180 WP_003153093.1 YqzE family protein -
  GI367_RS07760 (GI367_07760) comGG 1685838..1686215 (-) 378 WP_007612567.1 competence type IV pilus minor pilin ComGG Machinery gene
  GI367_RS07765 (GI367_07765) comGF 1686216..1686680 (-) 465 WP_228767516.1 competence type IV pilus minor pilin ComGF -
  GI367_RS07770 (GI367_07770) comGE 1686625..1686939 (-) 315 WP_029326075.1 competence type IV pilus minor pilin ComGE -
  GI367_RS07775 (GI367_07775) comGD 1686923..1687360 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  GI367_RS07780 (GI367_07780) comGC 1687350..1687616 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  GI367_RS07785 (GI367_07785) comGB 1687663..1688700 (-) 1038 WP_029326074.1 competence type IV pilus assembly protein ComGB Machinery gene
  GI367_RS07790 (GI367_07790) comGA 1688687..1689757 (-) 1071 WP_007612574.1 competence type IV pilus ATPase ComGA Machinery gene
  GI367_RS07795 (GI367_07795) - 1689954..1690904 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -
  GI367_RS07800 (GI367_07800) - 1691050..1692351 (+) 1302 WP_007612576.1 hemolysin family protein -

Sequence


Protein


Download         Length: 88 a.a.        Molecular weight: 9721.32 Da        Isoelectric Point: 6.2027

>NTDB_id=399250 GI367_RS07780 WP_042635730.1 1687350..1687616(-) (comGC) [Bacillus velezensis strain AL7]
MLIVLFIVSILLLITIPNVTKHNQSIQHKGCEGLQNMVKAQVTAYEIDHEGKMPDMNDLQSEGYIKKNTACPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=399250 GI367_RS07780 WP_042635730.1 1687350..1687616(-) (comGC) [Bacillus velezensis strain AL7]
ATGCTGATTGTTTTATTTATCGTTTCCATTCTGCTTTTAATTACCATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCATAAAGGCTGTGAAGGACTGCAGAATATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGATCATGAAGGTAAAATGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAGAATACAGCCTGCCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACAGTTGAACAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

74.648

80.682

0.602


Multiple sequence alignment