Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   GI367_RS07725 Genome accession   NZ_CP045926
Coordinates   1682306..1682479 (+) Length   57 a.a.
NCBI ID   WP_007612543.1    Uniprot ID   -
Organism   Bacillus velezensis strain AL7     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1677306..1687479
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GI367_RS07710 (GI367_07710) gcvT 1678119..1679219 (-) 1101 WP_029326079.1 glycine cleavage system aminomethyltransferase GcvT -
  GI367_RS07715 (GI367_07715) - 1679643..1681313 (+) 1671 WP_029326078.1 DEAD/DEAH box helicase -
  GI367_RS07720 (GI367_07720) - 1681335..1682129 (+) 795 WP_007612541.1 YqhG family protein -
  GI367_RS07725 (GI367_07725) sinI 1682306..1682479 (+) 174 WP_007612543.1 anti-repressor SinI Regulator
  GI367_RS07730 (GI367_07730) sinR 1682513..1682848 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  GI367_RS07735 (GI367_07735) tasA 1682896..1683681 (-) 786 WP_007612547.1 biofilm matrix protein TasA -
  GI367_RS07740 (GI367_07740) sipW 1683746..1684330 (-) 585 WP_007612550.1 signal peptidase I SipW -
  GI367_RS07745 (GI367_07745) tapA 1684302..1684973 (-) 672 WP_029326077.1 amyloid fiber anchoring/assembly protein TapA -
  GI367_RS07750 (GI367_07750) - 1685232..1685561 (+) 330 WP_007612559.1 DUF3889 domain-containing protein -
  GI367_RS07755 (GI367_07755) - 1685602..1685781 (-) 180 WP_003153093.1 YqzE family protein -
  GI367_RS07760 (GI367_07760) comGG 1685838..1686215 (-) 378 WP_007612567.1 competence type IV pilus minor pilin ComGG Machinery gene
  GI367_RS07765 (GI367_07765) comGF 1686216..1686680 (-) 465 WP_228767516.1 competence type IV pilus minor pilin ComGF -
  GI367_RS07770 (GI367_07770) comGE 1686625..1686939 (-) 315 WP_029326075.1 competence type IV pilus minor pilin ComGE -
  GI367_RS07775 (GI367_07775) comGD 1686923..1687360 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6672.68 Da        Isoelectric Point: 9.8168

>NTDB_id=399246 GI367_RS07725 WP_007612543.1 1682306..1682479(+) (sinI) [Bacillus velezensis strain AL7]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=399246 GI367_RS07725 WP_007612543.1 1682306..1682479(+) (sinI) [Bacillus velezensis strain AL7]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719

Multiple sequence alignment