Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   GII87_RS17180 Genome accession   NZ_CP045922
Coordinates   3256680..3256820 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain P8_B1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3251680..3261820
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GII87_RS17155 (GII87_17155) yuxO 3251993..3252373 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  GII87_RS17160 (GII87_17160) comA 3252392..3253036 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  GII87_RS17165 (GII87_17165) comP 3253117..3255426 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  GII87_RS17170 (GII87_17170) comX 3255441..3255608 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  GII87_RS17175 (GII87_17175) comQ 3255596..3256495 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  GII87_RS17180 (GII87_17180) degQ 3256680..3256820 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  GII87_RS17185 (GII87_17185) - 3257042..3257167 (+) 126 WP_003228793.1 hypothetical protein -
  GII87_RS17190 (GII87_17190) - 3257281..3257649 (+) 369 WP_003243784.1 hypothetical protein -
  GII87_RS17195 (GII87_17195) pdeH 3257625..3258854 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  GII87_RS17200 (GII87_17200) pncB 3258991..3260463 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  GII87_RS17205 (GII87_17205) pncA 3260479..3261030 (-) 552 WP_003243099.1 isochorismatase family cysteine hydrolase -
  GII87_RS17210 (GII87_17210) yueI 3261127..3261525 (-) 399 WP_003242987.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=399151 GII87_RS17180 WP_003220708.1 3256680..3256820(-) (degQ) [Bacillus subtilis strain P8_B1]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=399151 GII87_RS17180 WP_003220708.1 3256680..3256820(-) (degQ) [Bacillus subtilis strain P8_B1]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment