Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   GII76_RS12855 Genome accession   NZ_CP045826
Coordinates   2485956..2486129 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain 73     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2480956..2491129
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GII76_RS12840 (GII76_12840) gcvT 2481756..2482844 (-) 1089 WP_015714248.1 glycine cleavage system aminomethyltransferase GcvT -
  GII76_RS12845 (GII76_12845) hepAA 2483285..2484958 (+) 1674 WP_029726726.1 SNF2-related protein -
  GII76_RS12850 (GII76_12850) yqhG 2484979..2485773 (+) 795 WP_015714249.1 YqhG family protein -
  GII76_RS12855 (GII76_12855) sinI 2485956..2486129 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  GII76_RS12860 (GII76_12860) sinR 2486163..2486498 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  GII76_RS12865 (GII76_12865) tasA 2486591..2487376 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  GII76_RS12870 (GII76_12870) sipW 2487440..2488012 (-) 573 WP_072692741.1 signal peptidase I SipW -
  GII76_RS12875 (GII76_12875) tapA 2487996..2488757 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  GII76_RS12880 (GII76_12880) yqzG 2489029..2489355 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  GII76_RS12885 (GII76_12885) spoIITA 2489397..2489576 (-) 180 WP_029726723.1 YqzE family protein -
  GII76_RS12890 (GII76_12890) comGG 2489648..2490022 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  GII76_RS12895 (GII76_12895) comGF 2490023..2490406 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  GII76_RS12900 (GII76_12900) comGE 2490432..2490779 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=398384 GII76_RS12855 WP_003230187.1 2485956..2486129(+) (sinI) [Bacillus subtilis strain 73]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=398384 GII76_RS12855 WP_003230187.1 2485956..2486129(+) (sinI) [Bacillus subtilis strain 73]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment