Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   GII76_RS12895 Genome accession   NZ_CP045826
Coordinates   2490023..2490406 (-) Length   127 a.a.
NCBI ID   WP_029726721.1    Uniprot ID   -
Organism   Bacillus subtilis strain 73     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2485023..2495406
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GII76_RS12855 (GII76_12855) sinI 2485956..2486129 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  GII76_RS12860 (GII76_12860) sinR 2486163..2486498 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  GII76_RS12865 (GII76_12865) tasA 2486591..2487376 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  GII76_RS12870 (GII76_12870) sipW 2487440..2488012 (-) 573 WP_072692741.1 signal peptidase I SipW -
  GII76_RS12875 (GII76_12875) tapA 2487996..2488757 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  GII76_RS12880 (GII76_12880) yqzG 2489029..2489355 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  GII76_RS12885 (GII76_12885) spoIITA 2489397..2489576 (-) 180 WP_029726723.1 YqzE family protein -
  GII76_RS12890 (GII76_12890) comGG 2489648..2490022 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  GII76_RS12895 (GII76_12895) comGF 2490023..2490406 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  GII76_RS12900 (GII76_12900) comGE 2490432..2490779 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  GII76_RS12905 (GII76_12905) comGD 2490763..2491194 (-) 432 WP_029726720.1 comG operon protein ComGD Machinery gene
  GII76_RS12910 (GII76_12910) comGC 2491184..2491480 (-) 297 WP_029726719.1 comG operon protein ComGC Machinery gene
  GII76_RS12915 (GII76_12915) comGB 2491494..2492531 (-) 1038 WP_029726718.1 comG operon protein ComGB Machinery gene
  GII76_RS12920 (GII76_12920) comGA 2492518..2493588 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  GII76_RS12925 (GII76_12925) - 2493801..2493998 (-) 198 WP_029726717.1 hypothetical protein -
  GII76_RS12930 (GII76_12930) corA 2494000..2494953 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14409.52 Da        Isoelectric Point: 5.8940

>NTDB_id=398387 GII76_RS12895 WP_029726721.1 2490023..2490406(-) (comGF) [Bacillus subtilis strain 73]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADFENCVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=398387 GII76_RS12895 WP_029726721.1 2490023..2490406(-) (comGF) [Bacillus subtilis strain 73]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGT
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATTGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

96.85

100

0.969


Multiple sequence alignment