Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   GII78_RS13315 Genome accession   NZ_CP045824
Coordinates   2553758..2554141 (-) Length   127 a.a.
NCBI ID   WP_029726721.1    Uniprot ID   -
Organism   Bacillus subtilis strain MB8_B10     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2548758..2559141
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GII78_RS13275 (GII78_13275) sinI 2549691..2549864 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  GII78_RS13280 (GII78_13280) sinR 2549898..2550233 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  GII78_RS13285 (GII78_13285) tasA 2550326..2551111 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  GII78_RS13290 (GII78_13290) sipW 2551175..2551747 (-) 573 WP_072692741.1 signal peptidase I SipW -
  GII78_RS13295 (GII78_13295) tapA 2551731..2552492 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  GII78_RS13300 (GII78_13300) yqzG 2552764..2553090 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  GII78_RS13305 (GII78_13305) spoIITA 2553132..2553311 (-) 180 WP_029726723.1 YqzE family protein -
  GII78_RS13310 (GII78_13310) comGG 2553383..2553757 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  GII78_RS13315 (GII78_13315) comGF 2553758..2554141 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  GII78_RS13320 (GII78_13320) comGE 2554167..2554514 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  GII78_RS13325 (GII78_13325) comGD 2554498..2554929 (-) 432 WP_029726720.1 comG operon protein ComGD Machinery gene
  GII78_RS13330 (GII78_13330) comGC 2554919..2555215 (-) 297 WP_029726719.1 comG operon protein ComGC Machinery gene
  GII78_RS13335 (GII78_13335) comGB 2555229..2556266 (-) 1038 WP_029726718.1 comG operon protein ComGB Machinery gene
  GII78_RS13340 (GII78_13340) comGA 2556253..2557323 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  GII78_RS13345 (GII78_13345) - 2557536..2557733 (-) 198 WP_029726717.1 hypothetical protein -
  GII78_RS13350 (GII78_13350) corA 2557735..2558688 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14409.52 Da        Isoelectric Point: 5.8940

>NTDB_id=398227 GII78_RS13315 WP_029726721.1 2553758..2554141(-) (comGF) [Bacillus subtilis strain MB8_B10]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADFENCVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=398227 GII78_RS13315 WP_029726721.1 2553758..2554141(-) (comGF) [Bacillus subtilis strain MB8_B10]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGT
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATTGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

96.85

100

0.969


Multiple sequence alignment