Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   GII79_RS17110 Genome accession   NZ_CP045823
Coordinates   3259808..3259948 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain MB8_B1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3254808..3264948
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GII79_RS17085 (GII79_17085) yuxO 3255158..3255538 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  GII79_RS17090 (GII79_17090) comA 3255557..3256201 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  GII79_RS17095 (GII79_17095) comP 3256282..3258579 (-) 2298 WP_153912412.1 histidine kinase Regulator
  GII79_RS17100 (GII79_17100) comX 3258587..3258748 (-) 162 WP_049140565.1 competence pheromone ComX -
  GII79_RS17105 (GII79_17105) - 3258763..3259623 (-) 861 WP_040081966.1 polyprenyl synthetase family protein -
  GII79_RS17110 (GII79_17110) degQ 3259808..3259948 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  GII79_RS17115 (GII79_17115) - 3260170..3260295 (+) 126 WP_003228793.1 hypothetical protein -
  GII79_RS17120 (GII79_17120) - 3260411..3260779 (+) 369 WP_119899729.1 hypothetical protein -
  GII79_RS17125 (GII79_17125) pdeH 3260755..3261984 (-) 1230 WP_046381301.1 cyclic di-GMP phosphodiesterase -
  GII79_RS17130 (GII79_17130) pncB 3262121..3263593 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  GII79_RS17135 (GII79_17135) pncA 3263609..3264160 (-) 552 WP_088326850.1 isochorismatase family cysteine hydrolase -
  GII79_RS17140 (GII79_17140) yueI 3264257..3264655 (-) 399 WP_015251331.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=398169 GII79_RS17110 WP_003220708.1 3259808..3259948(-) (degQ) [Bacillus subtilis strain MB8_B1]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=398169 GII79_RS17110 WP_003220708.1 3259808..3259948(-) (degQ) [Bacillus subtilis strain MB8_B1]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment