Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   GII86_RS16965 Genome accession   NZ_CP045816
Coordinates   3151080..3151220 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain P5_B2     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3146080..3156220
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GII86_RS16940 (GII86_16940) yuxO 3146430..3146810 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  GII86_RS16945 (GII86_16945) comA 3146829..3147473 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  GII86_RS16950 (GII86_16950) comP 3147554..3149851 (-) 2298 WP_087614687.1 histidine kinase Regulator
  GII86_RS16955 (GII86_16955) comX 3149859..3150020 (-) 162 WP_003241045.1 competence pheromone ComX -
  GII86_RS16960 (GII86_16960) - 3150035..3150895 (-) 861 WP_046160795.1 polyprenyl synthetase family protein -
  GII86_RS16965 (GII86_16965) degQ 3151080..3151220 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  GII86_RS16970 (GII86_16970) - 3151442..3151567 (+) 126 WP_120028613.1 hypothetical protein -
  GII86_RS16975 (GII86_16975) - 3151682..3152050 (+) 369 WP_046160796.1 hypothetical protein -
  GII86_RS16980 (GII86_16980) pdeH 3152026..3153255 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  GII86_RS16985 (GII86_16985) pncB 3153392..3154864 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  GII86_RS16990 (GII86_16990) pncA 3154880..3155431 (-) 552 WP_046160797.1 isochorismatase family cysteine hydrolase -
  GII86_RS16995 (GII86_16995) yueI 3155528..3155926 (-) 399 WP_015251331.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=397685 GII86_RS16965 WP_003220708.1 3151080..3151220(-) (degQ) [Bacillus subtilis strain P5_B2]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=397685 GII86_RS16965 WP_003220708.1 3151080..3151220(-) (degQ) [Bacillus subtilis strain P5_B2]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment