Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   GII90_RS12180 Genome accession   NZ_CP045811
Coordinates   2397065..2397238 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain P9_B1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2392065..2402238
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GII90_RS12165 (GII90_12165) gcvT 2392864..2393952 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  GII90_RS12170 (GII90_12170) hepAA 2394394..2396067 (+) 1674 WP_004398544.1 SNF2-related protein -
  GII90_RS12175 (GII90_12175) yqhG 2396088..2396882 (+) 795 WP_003230200.1 YqhG family protein -
  GII90_RS12180 (GII90_12180) sinI 2397065..2397238 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  GII90_RS12185 (GII90_12185) sinR 2397272..2397607 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  GII90_RS12190 (GII90_12190) tasA 2397700..2398485 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  GII90_RS12195 (GII90_12195) sipW 2398549..2399121 (-) 573 WP_003246088.1 signal peptidase I SipW -
  GII90_RS12200 (GII90_12200) tapA 2399105..2399866 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  GII90_RS12205 (GII90_12205) yqzG 2400138..2400464 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  GII90_RS12210 (GII90_12210) spoIITA 2400506..2400685 (-) 180 WP_003230176.1 YqzE family protein -
  GII90_RS12215 (GII90_12215) comGG 2400756..2401130 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  GII90_RS12220 (GII90_12220) comGF 2401131..2401514 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  GII90_RS12225 (GII90_12225) comGE 2401540..2401887 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=397422 GII90_RS12180 WP_003230187.1 2397065..2397238(+) (sinI) [Bacillus subtilis strain P9_B1]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=397422 GII90_RS12180 WP_003230187.1 2397065..2397238(+) (sinI) [Bacillus subtilis strain P9_B1]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment