Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   GII90_RS12220 Genome accession   NZ_CP045811
Coordinates   2401131..2401514 (-) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   -
Organism   Bacillus subtilis strain P9_B1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2396131..2406514
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GII90_RS12180 (GII90_12180) sinI 2397065..2397238 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  GII90_RS12185 (GII90_12185) sinR 2397272..2397607 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  GII90_RS12190 (GII90_12190) tasA 2397700..2398485 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  GII90_RS12195 (GII90_12195) sipW 2398549..2399121 (-) 573 WP_003246088.1 signal peptidase I SipW -
  GII90_RS12200 (GII90_12200) tapA 2399105..2399866 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  GII90_RS12205 (GII90_12205) yqzG 2400138..2400464 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  GII90_RS12210 (GII90_12210) spoIITA 2400506..2400685 (-) 180 WP_003230176.1 YqzE family protein -
  GII90_RS12215 (GII90_12215) comGG 2400756..2401130 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  GII90_RS12220 (GII90_12220) comGF 2401131..2401514 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  GII90_RS12225 (GII90_12225) comGE 2401540..2401887 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  GII90_RS12230 (GII90_12230) comGD 2401871..2402302 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  GII90_RS12235 (GII90_12235) comGC 2402292..2402588 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  GII90_RS12240 (GII90_12240) comGB 2402602..2403639 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  GII90_RS12245 (GII90_12245) comGA 2403626..2404696 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  GII90_RS12250 (GII90_12250) corA 2405108..2406061 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=397425 GII90_RS12220 WP_003230168.1 2401131..2401514(-) (comGF) [Bacillus subtilis strain P9_B1]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=397425 GII90_RS12220 WP_003230168.1 2401131..2401514(-) (comGF) [Bacillus subtilis strain P9_B1]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment