Detailed information
Bioinformatically predicted
Overview
| Name | comE | Type | Machinery gene |
| Locus tag | GHB96_RS05705 | Genome accession | NZ_CP045707 |
| Coordinates | 1099011..1099406 (-) | Length | 131 a.a. |
| NCBI ID | WP_003703428.1 | Uniprot ID | - |
| Organism | Neisseria gonorrhoeae strain NG250 | ||
| Function | DNA binding (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1033722..1105905 | 1099011..1099406 | within | 0 |
Gene organization within MGE regions
Location: 1033722..1105905
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GHB96_RS05285 (GHB96_05625) | - | 1033722..1035158 (+) | 1437 | WP_012503729.1 | MBOAT family protein | - |
| GHB96_RS05290 (GHB96_05630) | patB | 1035169..1036152 (+) | 984 | WP_003692901.1 | peptidoglycan O-acetyltransferase PatB | - |
| GHB96_RS05295 (GHB96_05635) | - | 1036149..1037342 (+) | 1194 | WP_003689034.1 | SGNH/GDSL hydrolase family protein | - |
| GHB96_RS12100 | - | 1037414..1037542 (-) | 129 | WP_255294324.1 | hypothetical protein | - |
| GHB96_RS05300 (GHB96_05640) | - | 1037593..1039146 (+) | 1554 | WP_003689036.1 | fatty acid--CoA ligase | - |
| GHB96_RS05305 (GHB96_05645) | - | 1039235..1041262 (-) | 2028 | WP_003689037.1 | BCCT family transporter | - |
| GHB96_RS05310 (GHB96_05650) | - | 1041396..1042049 (-) | 654 | WP_215772550.1 | IS1595 family transposase | - |
| GHB96_RS05315 | - | 1042127..1042432 (-) | 306 | WP_082294427.1 | hypothetical protein | - |
| GHB96_RS05320 (GHB96_05655) | purM | 1043050..1044084 (-) | 1035 | WP_003698590.1 | phosphoribosylformylglycinamidine cyclo-ligase | - |
| GHB96_RS05325 (GHB96_05660) | - | 1044325..1044513 (+) | 189 | WP_003689039.1 | hypothetical protein | - |
| GHB96_RS05330 (GHB96_05665) | - | 1044773..1045762 (+) | 990 | WP_003689040.1 | site-specific integrase | - |
| GHB96_RS05335 (GHB96_05670) | - | 1046104..1046583 (+) | 480 | WP_002241413.1 | DUF4760 domain-containing protein | - |
| GHB96_RS05340 (GHB96_05675) | - | 1046643..1049690 (-) | 3048 | WP_215772551.1 | tape measure protein | - |
| GHB96_RS05345 (GHB96_05685) | - | 1050181..1050354 (-) | 174 | WP_017146757.1 | hypothetical protein | - |
| GHB96_RS05350 (GHB96_05690) | - | 1050338..1050682 (-) | 345 | WP_003695464.1 | hypothetical protein | - |
| GHB96_RS05355 (GHB96_05695) | - | 1050683..1051222 (-) | 540 | WP_050163081.1 | TIGR02594 family protein | - |
| GHB96_RS12105 | - | 1051264..1051389 (-) | 126 | WP_255294325.1 | hypothetical protein | - |
| GHB96_RS05360 (GHB96_05700) | - | 1051429..1051665 (+) | 237 | WP_003689049.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| GHB96_RS05365 (GHB96_05705) | - | 1051665..1052012 (+) | 348 | WP_003689051.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| GHB96_RS05370 (GHB96_05710) | - | 1052020..1052253 (+) | 234 | WP_003692884.1 | hypothetical protein | - |
| GHB96_RS05375 (GHB96_05715) | - | 1052383..1052715 (-) | 333 | WP_003691408.1 | hypothetical protein | - |
| GHB96_RS05380 (GHB96_05720) | - | 1052716..1053186 (-) | 471 | WP_003691410.1 | hypothetical protein | - |
| GHB96_RS05385 (GHB96_05725) | - | 1053257..1053562 (-) | 306 | WP_003689058.1 | hypothetical protein | - |
| GHB96_RS05390 (GHB96_05730) | - | 1053674..1057819 (-) | 4146 | WP_215772552.1 | phage tail protein | - |
| GHB96_RS05395 (GHB96_05735) | - | 1058059..1058337 (+) | 279 | WP_003692877.1 | XRE family transcriptional regulator | - |
| GHB96_RS05400 (GHB96_05740) | - | 1058365..1058796 (-) | 432 | WP_003689064.1 | NlpC/P60 family protein | - |
| GHB96_RS05405 (GHB96_05745) | - | 1058798..1059652 (-) | 855 | WP_003698614.1 | DUF2163 domain-containing protein | - |
| GHB96_RS05410 (GHB96_05750) | - | 1059649..1060248 (-) | 600 | WP_003692874.1 | DUF2460 domain-containing protein | - |
| GHB96_RS05415 (GHB96_05755) | - | 1060248..1060514 (-) | 267 | WP_003689070.1 | hypothetical protein | - |
| GHB96_RS05420 (GHB96_05760) | - | 1060526..1060855 (-) | 330 | WP_003692871.1 | hypothetical protein | - |
| GHB96_RS05425 (GHB96_05765) | - | 1060916..1061689 (-) | 774 | WP_003691416.1 | hypothetical protein | - |
| GHB96_RS05430 (GHB96_05770) | - | 1061715..1062143 (-) | 429 | WP_003689076.1 | hypothetical protein | - |
| GHB96_RS05435 (GHB96_05775) | - | 1062140..1062622 (-) | 483 | WP_010360061.1 | HK97 gp10 family phage protein | - |
| GHB96_RS05440 (GHB96_05780) | - | 1062622..1063152 (-) | 531 | WP_003689080.1 | head-tail connector protein | - |
| GHB96_RS05445 (GHB96_05785) | - | 1063155..1063517 (-) | 363 | WP_003689082.1 | hypothetical protein | - |
| GHB96_RS05450 (GHB96_05790) | - | 1063524..1065023 (-) | 1500 | WP_003689084.1 | hypothetical protein | - |
| GHB96_RS05455 (GHB96_05795) | - | 1065064..1066221 (-) | 1158 | WP_003691421.1 | HK97 family phage prohead protease | - |
| GHB96_RS05460 (GHB96_05800) | - | 1066289..1068436 (-) | 2148 | WP_003691423.1 | phage portal protein | - |
| GHB96_RS05465 (GHB96_05805) | terL | 1068433..1069854 (-) | 1422 | WP_003697216.1 | phage terminase large subunit | - |
| GHB96_RS05470 (GHB96_05810) | - | 1069916..1070365 (-) | 450 | WP_003695485.1 | hypothetical protein | - |
| GHB96_RS05475 (GHB96_05815) | - | 1070658..1071500 (-) | 843 | WP_215772553.1 | BRO family protein | - |
| GHB96_RS05480 (GHB96_05820) | - | 1071783..1072742 (-) | 960 | WP_123768253.1 | hypothetical protein | - |
| GHB96_RS05485 (GHB96_05825) | - | 1072803..1073210 (-) | 408 | WP_215319208.1 | hypothetical protein | - |
| GHB96_RS05490 (GHB96_05835) | - | 1073477..1073857 (-) | 381 | WP_225577399.1 | RusA family crossover junction endodeoxyribonuclease | - |
| GHB96_RS11875 | - | 1073848..1074129 (-) | 282 | WP_003689109.1 | hypothetical protein | - |
| GHB96_RS05495 (GHB96_05840) | - | 1074158..1074307 (-) | 150 | WP_003689110.1 | hypothetical protein | - |
| GHB96_RS05500 (GHB96_05845) | - | 1074484..1074978 (-) | 495 | WP_041421248.1 | DUF3310 domain-containing protein | - |
| GHB96_RS05505 (GHB96_05850) | - | 1075070..1075300 (-) | 231 | WP_012503490.1 | hypothetical protein | - |
| GHB96_RS05510 (GHB96_05855) | - | 1075293..1076075 (-) | 783 | WP_033910919.1 | ATP-binding protein | - |
| GHB96_RS05515 (GHB96_05860) | - | 1076091..1076981 (-) | 891 | WP_050171074.1 | replication protein | - |
| GHB96_RS05520 (GHB96_05865) | - | 1077084..1077329 (-) | 246 | WP_014580642.1 | YdaS family helix-turn-helix protein | - |
| GHB96_RS05525 (GHB96_05870) | - | 1077428..1078126 (+) | 699 | WP_002255715.1 | S24 family peptidase | - |
| GHB96_RS05530 (GHB96_05875) | - | 1078126..1078686 (+) | 561 | WP_002231760.1 | hypothetical protein | - |
| GHB96_RS05535 (GHB96_05880) | - | 1079006..1079206 (+) | 201 | WP_047954343.1 | hypothetical protein | - |
| GHB96_RS05540 (GHB96_05885) | - | 1079239..1079715 (+) | 477 | WP_002255718.1 | hypothetical protein | - |
| GHB96_RS05545 (GHB96_05890) | - | 1079712..1079999 (+) | 288 | WP_215772512.1 | hypothetical protein | - |
| GHB96_RS05550 (GHB96_05895) | - | 1080141..1080473 (+) | 333 | WP_050155386.1 | hypothetical protein | - |
| GHB96_RS05555 (GHB96_05900) | - | 1080626..1080901 (+) | 276 | WP_082295533.1 | NGO1622 family putative holin | - |
| GHB96_RS05560 (GHB96_05905) | - | 1080898..1081059 (+) | 162 | WP_003693867.1 | hypothetical protein | - |
| GHB96_RS05565 (GHB96_05910) | - | 1081128..1081814 (+) | 687 | WP_010357532.1 | phage replication initiation protein, NGO0469 family | - |
| GHB96_RS05570 (GHB96_05915) | - | 1081954..1082136 (+) | 183 | WP_003691535.1 | hypothetical protein | - |
| GHB96_RS05575 (GHB96_05920) | - | 1082133..1082624 (+) | 492 | WP_047916888.1 | siphovirus Gp157 family protein | - |
| GHB96_RS05580 (GHB96_05925) | - | 1082676..1082891 (+) | 216 | WP_003691538.1 | hypothetical protein | - |
| GHB96_RS05585 (GHB96_05930) | - | 1083002..1083985 (+) | 984 | WP_050169789.1 | hypothetical protein | - |
| GHB96_RS05590 (GHB96_05935) | - | 1083982..1084395 (+) | 414 | WP_003705983.1 | hypothetical protein | - |
| GHB96_RS05595 (GHB96_05940) | - | 1084421..1084615 (+) | 195 | WP_003689159.1 | hypothetical protein | - |
| GHB96_RS05605 (GHB96_05950) | - | 1084906..1085580 (+) | 675 | WP_003689160.1 | hypothetical protein | - |
| GHB96_RS05610 (GHB96_05955) | ribA | 1085573..1086166 (+) | 594 | WP_003689161.1 | GTP cyclohydrolase II | - |
| GHB96_RS05615 (GHB96_05960) | - | 1086334..1086516 (+) | 183 | Protein_1114 | glycosyltransferase | - |
| GHB96_RS05620 (GHB96_05965) | - | 1086519..1087481 (+) | 963 | WP_215772493.1 | IS110 family transposase | - |
| GHB96_RS05625 (GHB96_05970) | - | 1088117..1088476 (-) | 360 | WP_003689732.1 | hypothetical protein | - |
| GHB96_RS05630 (GHB96_05975) | - | 1088597..1089684 (-) | 1088 | Protein_1117 | zonular occludens toxin domain-containing protein | - |
| GHB96_RS05635 (GHB96_05980) | - | 1089694..1089984 (-) | 291 | WP_050173549.1 | DUF2523 domain-containing protein | - |
| GHB96_RS05640 (GHB96_05985) | - | 1089963..1091552 (-) | 1590 | WP_215772494.1 | IgG-binding virulence factor TspB family protein | - |
| GHB96_RS05645 (GHB96_05990) | - | 1091494..1091811 (-) | 318 | WP_003689167.1 | DUF1132 family protein | - |
| GHB96_RS05650 (GHB96_05995) | - | 1091939..1092217 (-) | 279 | WP_003689168.1 | hypothetical protein | - |
| GHB96_RS05655 (GHB96_06000) | - | 1092224..1092443 (-) | 220 | Protein_1122 | major capsid protein | - |
| GHB96_RS05660 (GHB96_06005) | - | 1092517..1092714 (-) | 198 | WP_003689600.1 | hypothetical protein | - |
| GHB96_RS05665 (GHB96_06010) | - | 1092719..1093009 (-) | 291 | WP_047922571.1 | hypothetical protein | - |
| GHB96_RS05670 (GHB96_06015) | - | 1093054..1094395 (-) | 1342 | Protein_1125 | replication initiation factor domain-containing protein | - |
| GHB96_RS05675 (GHB96_06020) | - | 1094533..1094955 (-) | 423 | WP_003691751.1 | very short patch repair endonuclease | - |
| GHB96_RS11880 | - | 1094961..1095557 (-) | 597 | WP_012503916.1 | TIGR02391 family protein | - |
| GHB96_RS11885 | - | 1095747..1096604 (-) | 858 | WP_012503917.1 | ATP-binding protein | - |
| GHB96_RS05685 (GHB96_06030) | - | 1096618..1097052 (-) | 435 | WP_229684538.1 | DNA cytosine methyltransferase | - |
| GHB96_RS05690 (GHB96_06035) | - | 1096986..1097576 (-) | 591 | WP_080229150.1 | DNA cytosine methyltransferase | - |
| GHB96_RS05695 (GHB96_06040) | - | 1097951..1098097 (+) | 147 | WP_003691757.1 | hypothetical protein | - |
| GHB96_RS05700 (GHB96_06050) | comP | 1098474..1098923 (-) | 450 | WP_002214937.1 | type IV pilin protein | Machinery gene |
| GHB96_RS05705 (GHB96_06055) | comE | 1099011..1099406 (-) | 396 | WP_003703428.1 | helix-hairpin-helix domain-containing protein | Machinery gene |
| GHB96_RS11890 (GHB96_06060) | - | 1099508..1099627 (-) | 120 | Protein_1134 | competence protein ComE | - |
| GHB96_RS05735 (GHB96_06090) | - | 1105252..1105905 (-) | 654 | Protein_1135 | TIGR01621 family pseudouridine synthase | - |
Sequence
Protein
Download Length: 131 a.a. Molecular weight: 13796.61 Da Isoelectric Point: 10.8790
>NTDB_id=396165 GHB96_RS05705 WP_003703428.1 1099011..1099406(-) (comE) [Neisseria gonorrhoeae strain NG250]
MSRGGATPYRFLLIRHIVARCGLLFATLKGKTMKKMFVLFCMLFSCAFSLAAVNINAASQQELEALPGIGPAKAKAIAEY
RAQNGAFKSVDDLIKVKGIGPAVLAKLKDQASVGAPAPKGPAKPVLPAVKK
MSRGGATPYRFLLIRHIVARCGLLFATLKGKTMKKMFVLFCMLFSCAFSLAAVNINAASQQELEALPGIGPAKAKAIAEY
RAQNGAFKSVDDLIKVKGIGPAVLAKLKDQASVGAPAPKGPAKPVLPAVKK
Nucleotide
Download Length: 396 bp
>NTDB_id=396165 GHB96_RS05705 WP_003703428.1 1099011..1099406(-) (comE) [Neisseria gonorrhoeae strain NG250]
TTGAGCCGGGGCGGGGCAACGCCGTACCGGTTTTTGTTAATCCGCCATATCGTCGCAAGATGCGGTTTGTTGTTTGCAAC
CCTTAAAGGAAAAACCATGAAAAAAATGTTTGTATTGTTCTGTATGCTGTTCTCCTGCGCCTTCTCCCTTGCGGCGGTAA
ACATCAATGCGGCTTCGCAGCAGGAGCTGGAGGCGCTGCCGGGCATAGGCCCGGCGAAGGCGAAGGCCATTGCGGAATAC
CGCGCGCAAAACGGCGCGTTCAAGTCTGTGGACGATTTGATCAAGGTGAAGGGCATCGGTCCGGCGGTGCTGGCGAAGCT
GAAAGACCAGGCTTCCGTCGGCGCGCCCGCACCAAAAGGCCCCGCCAAACCGGTGCTGCCTGCGGTTAAAAAATAG
TTGAGCCGGGGCGGGGCAACGCCGTACCGGTTTTTGTTAATCCGCCATATCGTCGCAAGATGCGGTTTGTTGTTTGCAAC
CCTTAAAGGAAAAACCATGAAAAAAATGTTTGTATTGTTCTGTATGCTGTTCTCCTGCGCCTTCTCCCTTGCGGCGGTAA
ACATCAATGCGGCTTCGCAGCAGGAGCTGGAGGCGCTGCCGGGCATAGGCCCGGCGAAGGCGAAGGCCATTGCGGAATAC
CGCGCGCAAAACGGCGCGTTCAAGTCTGTGGACGATTTGATCAAGGTGAAGGGCATCGGTCCGGCGGTGCTGGCGAAGCT
GAAAGACCAGGCTTCCGTCGGCGCGCCCGCACCAAAAGGCCCCGCCAAACCGGTGCTGCCTGCGGTTAAAAAATAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comE | Neisseria gonorrhoeae MS11 |
100 |
100 |
1 |
| comE | Neisseria gonorrhoeae MS11 |
100 |
100 |
1 |
| comE | Neisseria gonorrhoeae MS11 |
100 |
100 |
1 |
| comE | Neisseria gonorrhoeae MS11 |
100 |
100 |
1 |