Detailed information
Bioinformatically predicted
Overview
| Name | pilK | Type | Machinery gene |
| Locus tag | GHB96_RS02320 | Genome accession | NZ_CP045707 |
| Coordinates | 449567..450166 (+) | Length | 199 a.a. |
| NCBI ID | WP_050157381.1 | Uniprot ID | - |
| Organism | Neisseria gonorrhoeae strain NG250 | ||
| Function | type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 435696..488623 | 449567..450166 | within | 0 |
Gene organization within MGE regions
Location: 435696..488623
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GHB96_RS02250 (GHB96_02370) | - | 435696..436679 (+) | 984 | WP_003687900.1 | ribose-phosphate pyrophosphokinase | - |
| GHB96_RS02255 (GHB96_02375) | - | 436746..437318 (+) | 573 | WP_003694964.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
| GHB96_RS02260 (GHB96_02380) | - | 437444..438613 (-) | 1170 | WP_003687902.1 | D-alanyl-D-alanine carboxypeptidase family protein | - |
| GHB96_RS02265 (GHB96_02385) | ilvA | 438762..440288 (+) | 1527 | WP_003690890.1 | threonine ammonia-lyase, biosynthetic | - |
| GHB96_RS02270 (GHB96_02390) | - | 440344..441420 (-) | 1077 | WP_003687905.1 | sulfate/molybdate ABC transporter ATP-binding protein | - |
| GHB96_RS02275 (GHB96_02395) | cysW | 441417..442277 (-) | 861 | WP_003690891.1 | sulfate ABC transporter permease subunit CysW | - |
| GHB96_RS02280 (GHB96_02400) | cysT | 442466..443302 (-) | 837 | WP_047923822.1 | sulfate ABC transporter permease subunit CysT | - |
| GHB96_RS02285 (GHB96_02405) | - | 443483..443815 (+) | 333 | WP_003687908.1 | hypothetical protein | - |
| GHB96_RS02290 (GHB96_02410) | - | 444146..444655 (+) | 510 | WP_003687909.1 | isoprenylcysteine carboxyl methyltransferase family protein | - |
| GHB96_RS02295 (GHB96_02415) | - | 444896..445477 (-) | 582 | WP_003698180.1 | superoxide dismutase | - |
| GHB96_RS02300 (GHB96_02420) | dnaB | 445640..447046 (+) | 1407 | WP_215772538.1 | replicative DNA helicase | - |
| GHB96_RS02305 (GHB96_02425) | pilH | 447354..448016 (+) | 663 | WP_215772539.1 | Tfp pilus assembly protein FimT/FimU | Machinery gene |
| GHB96_RS02310 (GHB96_02430) | pilI | 448048..448656 (+) | 609 | WP_215772540.1 | type IV pilus modification protein PilV | Machinery gene |
| GHB96_RS02315 (GHB96_02435) | pilJ | 448653..449588 (+) | 936 | WP_215772541.1 | PilW family protein | Machinery gene |
| GHB96_RS02320 (GHB96_02440) | pilK | 449567..450166 (+) | 600 | WP_050157381.1 | pilus assembly protein | Machinery gene |
| GHB96_RS02325 (GHB96_02445) | pilL | 450168..450641 (+) | 474 | WP_215772556.1 | PilX family type IV pilin | Machinery gene |
| GHB96_RS02330 (GHB96_02450) | - | 450711..451019 (-) | 309 | WP_025456241.1 | AzlD family protein | - |
| GHB96_RS02335 (GHB96_02455) | - | 451016..451727 (-) | 712 | Protein_459 | AzlC family ABC transporter permease | - |
| GHB96_RS02340 (GHB96_02460) | dut | 451893..452345 (+) | 453 | WP_003687923.1 | dUTP diphosphatase | - |
| GHB96_RS02345 (GHB96_02465) | dapC | 452423..453610 (+) | 1188 | WP_003687924.1 | succinyldiaminopimelate transaminase | - |
| GHB96_RS02350 (GHB96_02470) | yaaA | 453921..454700 (+) | 780 | WP_003687925.1 | peroxide stress protein YaaA | - |
| GHB96_RS02365 (GHB96_02485) | - | 455231..456433 (+) | 1203 | WP_215772557.1 | integrase arm-type DNA-binding domain-containing protein | - |
| GHB96_RS02370 (GHB96_02490) | - | 456789..457058 (-) | 270 | WP_003687928.1 | hypothetical protein | - |
| GHB96_RS02375 (GHB96_02495) | - | 457253..457936 (-) | 684 | WP_003687929.1 | DUF2786 domain-containing protein | - |
| GHB96_RS12175 | - | 458250..458483 (-) | 234 | Protein_466 | hypothetical protein | - |
| GHB96_RS02385 (GHB96_02505) | - | 458594..458809 (-) | 216 | WP_003691538.1 | hypothetical protein | - |
| GHB96_RS02390 (GHB96_02510) | - | 458861..459352 (-) | 492 | WP_047916888.1 | siphovirus Gp157 family protein | - |
| GHB96_RS02395 (GHB96_02515) | - | 459349..459531 (-) | 183 | WP_003691535.1 | hypothetical protein | - |
| GHB96_RS02400 (GHB96_02520) | - | 459671..460357 (-) | 687 | WP_010357532.1 | phage replication initiation protein, NGO0469 family | - |
| GHB96_RS02405 (GHB96_02525) | - | 460426..460587 (-) | 162 | WP_003693867.1 | hypothetical protein | - |
| GHB96_RS02410 (GHB96_02530) | - | 460584..460859 (-) | 276 | WP_082295533.1 | NGO1622 family putative holin | - |
| GHB96_RS02415 (GHB96_02535) | - | 461012..461344 (-) | 333 | WP_050155386.1 | hypothetical protein | - |
| GHB96_RS02420 (GHB96_02540) | - | 461486..461773 (-) | 288 | WP_215772512.1 | hypothetical protein | - |
| GHB96_RS02425 (GHB96_02545) | - | 461770..462246 (-) | 477 | WP_002255718.1 | hypothetical protein | - |
| GHB96_RS02430 (GHB96_02550) | - | 462279..462479 (-) | 201 | WP_047954343.1 | hypothetical protein | - |
| GHB96_RS02435 (GHB96_02555) | - | 462677..463090 (-) | 414 | WP_003687963.1 | hypothetical protein | - |
| GHB96_RS02440 (GHB96_02560) | - | 463087..463548 (-) | 462 | WP_003687965.1 | helix-turn-helix transcriptional regulator | - |
| GHB96_RS02445 (GHB96_02565) | - | 463565..464002 (-) | 438 | WP_003687967.1 | hypothetical protein | - |
| GHB96_RS02450 (GHB96_02570) | - | 464115..464831 (-) | 717 | WP_003687969.1 | LexA family transcriptional regulator | - |
| GHB96_RS02455 (GHB96_02575) | - | 464900..465136 (+) | 237 | WP_003687971.1 | Cro/CI family transcriptional regulator | - |
| GHB96_RS02460 (GHB96_02580) | - | 465216..465371 (+) | 156 | WP_003689578.1 | hypothetical protein | - |
| GHB96_RS02465 (GHB96_02585) | - | 465348..465536 (-) | 189 | WP_003691445.1 | hypothetical protein | - |
| GHB96_RS02470 (GHB96_02590) | - | 465709..465972 (+) | 264 | WP_050161666.1 | helix-turn-helix domain-containing protein | - |
| GHB96_RS02475 (GHB96_02595) | - | 465969..466859 (+) | 891 | WP_050171074.1 | replication protein | - |
| GHB96_RS02480 (GHB96_02600) | - | 466875..467657 (+) | 783 | WP_050163162.1 | ATP-binding protein | - |
| GHB96_RS02485 (GHB96_02605) | - | 467650..467895 (+) | 246 | WP_050171075.1 | hypothetical protein | - |
| GHB96_RS02490 (GHB96_02610) | - | 467969..468463 (+) | 495 | WP_047923539.1 | DUF3310 domain-containing protein | - |
| GHB96_RS02495 (GHB96_02615) | - | 468640..468789 (+) | 150 | WP_012503493.1 | hypothetical protein | - |
| GHB96_RS11700 | - | 468818..469099 (+) | 282 | WP_003689109.1 | hypothetical protein | - |
| GHB96_RS02500 (GHB96_02620) | - | 469090..469527 (+) | 438 | WP_082286881.1 | RusA family crossover junction endodeoxyribonuclease | - |
| GHB96_RS02505 (GHB96_02625) | - | 469520..469825 (+) | 306 | WP_047951716.1 | DUF1364 domain-containing protein | - |
| GHB96_RS02510 (GHB96_02630) | - | 469822..470205 (+) | 384 | WP_050171029.1 | recombination protein NinB | - |
| GHB96_RS02515 (GHB96_02635) | - | 470196..470714 (+) | 519 | WP_003687984.1 | HNH endonuclease | - |
| GHB96_RS02520 (GHB96_02640) | - | 470779..471201 (+) | 423 | WP_003690919.1 | hypothetical protein | - |
| GHB96_RS02525 (GHB96_02645) | - | 471201..471443 (+) | 243 | WP_003706439.1 | hypothetical protein | - |
| GHB96_RS02530 (GHB96_02650) | - | 471498..471740 (+) | 243 | WP_003687989.1 | hypothetical protein | - |
| GHB96_RS02535 (GHB96_02655) | - | 471721..472995 (+) | 1275 | WP_010951185.1 | PBSX family phage terminase large subunit | - |
| GHB96_RS02540 (GHB96_02660) | - | 472980..475247 (+) | 2268 | WP_225577699.1 | hypothetical protein | - |
| GHB96_RS02545 (GHB96_02665) | - | 475484..476680 (+) | 1197 | WP_050171028.1 | hypothetical protein | - |
| GHB96_RS02550 (GHB96_02675) | - | 476677..483975 (+) | 7299 | WP_050171027.1 | PLxRFG domain-containing protein | - |
| GHB96_RS02560 (GHB96_02685) | - | 484601..485896 (+) | 1296 | WP_047951717.1 | DUF4043 family protein | - |
| GHB96_RS02565 (GHB96_02690) | - | 485951..486424 (+) | 474 | WP_003687996.1 | hypothetical protein | - |
| GHB96_RS02570 (GHB96_02695) | - | 486430..486915 (+) | 486 | WP_003687997.1 | hypothetical protein | - |
| GHB96_RS02575 (GHB96_02700) | - | 486912..487586 (+) | 675 | WP_003687998.1 | hypothetical protein | - |
| GHB96_RS02580 (GHB96_02705) | - | 487772..488623 (-) | 852 | WP_050171026.1 | Bro-N domain-containing protein | - |
Sequence
Protein
Download Length: 199 a.a. Molecular weight: 21709.74 Da Isoelectric Point: 8.4516
>NTDB_id=396153 GHB96_RS02320 WP_050157381.1 449567..450166(+) (pilK) [Neisseria gonorrhoeae strain NG250]
MRKQNTLTGIPTSDGQRGFALFIVLMVMIVVAFLVVTAAQSYNTEQRISANESDRKLALSLAEAALREGEFQVLDLEYAA
DSKVTFSENCEKGLCTAVNVRTNNNGNEEAFGNIVVKGKPIVEAVKRSCPANSASLCIDNRGMEYKKGTAGVSKMPRYII
EYLGVKNGQNVYRVTAKAWGKNANTVVVLQSYVGNNDEQ
MRKQNTLTGIPTSDGQRGFALFIVLMVMIVVAFLVVTAAQSYNTEQRISANESDRKLALSLAEAALREGEFQVLDLEYAA
DSKVTFSENCEKGLCTAVNVRTNNNGNEEAFGNIVVKGKPIVEAVKRSCPANSASLCIDNRGMEYKKGTAGVSKMPRYII
EYLGVKNGQNVYRVTAKAWGKNANTVVVLQSYVGNNDEQ
Nucleotide
Download Length: 600 bp
>NTDB_id=396153 GHB96_RS02320 WP_050157381.1 449567..450166(+) (pilK) [Neisseria gonorrhoeae strain NG250]
ATGCGCAAACAGAACACTTTGACAGGAATCCCGACTTCTGACGGACAGAGGGGGTTCGCACTGTTTATCGTGCTGATGGT
GATGATAGTCGTGGCCTTTTTGGTTGTAACTGCCGCCCAGTCCTACAATACCGAACAGAGGATCAGTGCCAACGAATCAG
ACAGGAAATTGGCTTTGTCTTTAGCCGAGGCGGCTTTGCGGGAGGGCGAATTTCAGGTTTTGGATTTGGAATATGCTGCG
GATAGTAAGGTTACATTTAGCGAAAACTGTGAAAAAGGCCTGTGTACCGCAGTGAATGTGCGGACAAATAATAATGGTAA
TGAAGAGGCTTTTGGCAATATCGTGGTGAAAGGCAAGCCCATCGTTGAGGCGGTGAAGCGTTCTTGCCCTGCAAATTCTG
CCAGCCTGTGCATTGACAATAGAGGGATGGAATATAAGAAAGGCACGGCAGGCGTCAGCAAAATGCCGCGCTATATTATC
GAATATTTAGGCGTGAAGAACGGACAAAATGTTTATCGGGTTACTGCCAAGGCTTGGGGTAAGAATGCCAATACCGTGGT
CGTCCTTCAATCTTATGTAGGCAATAATGATGAGCAATAA
ATGCGCAAACAGAACACTTTGACAGGAATCCCGACTTCTGACGGACAGAGGGGGTTCGCACTGTTTATCGTGCTGATGGT
GATGATAGTCGTGGCCTTTTTGGTTGTAACTGCCGCCCAGTCCTACAATACCGAACAGAGGATCAGTGCCAACGAATCAG
ACAGGAAATTGGCTTTGTCTTTAGCCGAGGCGGCTTTGCGGGAGGGCGAATTTCAGGTTTTGGATTTGGAATATGCTGCG
GATAGTAAGGTTACATTTAGCGAAAACTGTGAAAAAGGCCTGTGTACCGCAGTGAATGTGCGGACAAATAATAATGGTAA
TGAAGAGGCTTTTGGCAATATCGTGGTGAAAGGCAAGCCCATCGTTGAGGCGGTGAAGCGTTCTTGCCCTGCAAATTCTG
CCAGCCTGTGCATTGACAATAGAGGGATGGAATATAAGAAAGGCACGGCAGGCGTCAGCAAAATGCCGCGCTATATTATC
GAATATTTAGGCGTGAAGAACGGACAAAATGTTTATCGGGTTACTGCCAAGGCTTGGGGTAAGAATGCCAATACCGTGGT
CGTCCTTCAATCTTATGTAGGCAATAATGATGAGCAATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilK | Neisseria gonorrhoeae MS11 |
90.148 |
100 |
0.92 |