Detailed information    

insolico Bioinformatically predicted

Overview


Name   pilJ   Type   Machinery gene
Locus tag   GHB96_RS02315 Genome accession   NZ_CP045707
Coordinates   448653..449588 (+) Length   311 a.a.
NCBI ID   WP_215772541.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae strain NG250     
Function   type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 435696..488623 448653..449588 within 0


Gene organization within MGE regions


Location: 435696..488623
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GHB96_RS02250 (GHB96_02370) - 435696..436679 (+) 984 WP_003687900.1 ribose-phosphate pyrophosphokinase -
  GHB96_RS02255 (GHB96_02375) - 436746..437318 (+) 573 WP_003694964.1 50S ribosomal protein L25/general stress protein Ctc -
  GHB96_RS02260 (GHB96_02380) - 437444..438613 (-) 1170 WP_003687902.1 D-alanyl-D-alanine carboxypeptidase family protein -
  GHB96_RS02265 (GHB96_02385) ilvA 438762..440288 (+) 1527 WP_003690890.1 threonine ammonia-lyase, biosynthetic -
  GHB96_RS02270 (GHB96_02390) - 440344..441420 (-) 1077 WP_003687905.1 sulfate/molybdate ABC transporter ATP-binding protein -
  GHB96_RS02275 (GHB96_02395) cysW 441417..442277 (-) 861 WP_003690891.1 sulfate ABC transporter permease subunit CysW -
  GHB96_RS02280 (GHB96_02400) cysT 442466..443302 (-) 837 WP_047923822.1 sulfate ABC transporter permease subunit CysT -
  GHB96_RS02285 (GHB96_02405) - 443483..443815 (+) 333 WP_003687908.1 hypothetical protein -
  GHB96_RS02290 (GHB96_02410) - 444146..444655 (+) 510 WP_003687909.1 isoprenylcysteine carboxyl methyltransferase family protein -
  GHB96_RS02295 (GHB96_02415) - 444896..445477 (-) 582 WP_003698180.1 superoxide dismutase -
  GHB96_RS02300 (GHB96_02420) dnaB 445640..447046 (+) 1407 WP_215772538.1 replicative DNA helicase -
  GHB96_RS02305 (GHB96_02425) pilH 447354..448016 (+) 663 WP_215772539.1 Tfp pilus assembly protein FimT/FimU Machinery gene
  GHB96_RS02310 (GHB96_02430) pilI 448048..448656 (+) 609 WP_215772540.1 type IV pilus modification protein PilV Machinery gene
  GHB96_RS02315 (GHB96_02435) pilJ 448653..449588 (+) 936 WP_215772541.1 PilW family protein Machinery gene
  GHB96_RS02320 (GHB96_02440) pilK 449567..450166 (+) 600 WP_050157381.1 pilus assembly protein Machinery gene
  GHB96_RS02325 (GHB96_02445) pilL 450168..450641 (+) 474 WP_215772556.1 PilX family type IV pilin Machinery gene
  GHB96_RS02330 (GHB96_02450) - 450711..451019 (-) 309 WP_025456241.1 AzlD family protein -
  GHB96_RS02335 (GHB96_02455) - 451016..451727 (-) 712 Protein_459 AzlC family ABC transporter permease -
  GHB96_RS02340 (GHB96_02460) dut 451893..452345 (+) 453 WP_003687923.1 dUTP diphosphatase -
  GHB96_RS02345 (GHB96_02465) dapC 452423..453610 (+) 1188 WP_003687924.1 succinyldiaminopimelate transaminase -
  GHB96_RS02350 (GHB96_02470) yaaA 453921..454700 (+) 780 WP_003687925.1 peroxide stress protein YaaA -
  GHB96_RS02365 (GHB96_02485) - 455231..456433 (+) 1203 WP_215772557.1 integrase arm-type DNA-binding domain-containing protein -
  GHB96_RS02370 (GHB96_02490) - 456789..457058 (-) 270 WP_003687928.1 hypothetical protein -
  GHB96_RS02375 (GHB96_02495) - 457253..457936 (-) 684 WP_003687929.1 DUF2786 domain-containing protein -
  GHB96_RS12175 - 458250..458483 (-) 234 Protein_466 hypothetical protein -
  GHB96_RS02385 (GHB96_02505) - 458594..458809 (-) 216 WP_003691538.1 hypothetical protein -
  GHB96_RS02390 (GHB96_02510) - 458861..459352 (-) 492 WP_047916888.1 siphovirus Gp157 family protein -
  GHB96_RS02395 (GHB96_02515) - 459349..459531 (-) 183 WP_003691535.1 hypothetical protein -
  GHB96_RS02400 (GHB96_02520) - 459671..460357 (-) 687 WP_010357532.1 phage replication initiation protein, NGO0469 family -
  GHB96_RS02405 (GHB96_02525) - 460426..460587 (-) 162 WP_003693867.1 hypothetical protein -
  GHB96_RS02410 (GHB96_02530) - 460584..460859 (-) 276 WP_082295533.1 NGO1622 family putative holin -
  GHB96_RS02415 (GHB96_02535) - 461012..461344 (-) 333 WP_050155386.1 hypothetical protein -
  GHB96_RS02420 (GHB96_02540) - 461486..461773 (-) 288 WP_215772512.1 hypothetical protein -
  GHB96_RS02425 (GHB96_02545) - 461770..462246 (-) 477 WP_002255718.1 hypothetical protein -
  GHB96_RS02430 (GHB96_02550) - 462279..462479 (-) 201 WP_047954343.1 hypothetical protein -
  GHB96_RS02435 (GHB96_02555) - 462677..463090 (-) 414 WP_003687963.1 hypothetical protein -
  GHB96_RS02440 (GHB96_02560) - 463087..463548 (-) 462 WP_003687965.1 helix-turn-helix transcriptional regulator -
  GHB96_RS02445 (GHB96_02565) - 463565..464002 (-) 438 WP_003687967.1 hypothetical protein -
  GHB96_RS02450 (GHB96_02570) - 464115..464831 (-) 717 WP_003687969.1 LexA family transcriptional regulator -
  GHB96_RS02455 (GHB96_02575) - 464900..465136 (+) 237 WP_003687971.1 Cro/CI family transcriptional regulator -
  GHB96_RS02460 (GHB96_02580) - 465216..465371 (+) 156 WP_003689578.1 hypothetical protein -
  GHB96_RS02465 (GHB96_02585) - 465348..465536 (-) 189 WP_003691445.1 hypothetical protein -
  GHB96_RS02470 (GHB96_02590) - 465709..465972 (+) 264 WP_050161666.1 helix-turn-helix domain-containing protein -
  GHB96_RS02475 (GHB96_02595) - 465969..466859 (+) 891 WP_050171074.1 replication protein -
  GHB96_RS02480 (GHB96_02600) - 466875..467657 (+) 783 WP_050163162.1 ATP-binding protein -
  GHB96_RS02485 (GHB96_02605) - 467650..467895 (+) 246 WP_050171075.1 hypothetical protein -
  GHB96_RS02490 (GHB96_02610) - 467969..468463 (+) 495 WP_047923539.1 DUF3310 domain-containing protein -
  GHB96_RS02495 (GHB96_02615) - 468640..468789 (+) 150 WP_012503493.1 hypothetical protein -
  GHB96_RS11700 - 468818..469099 (+) 282 WP_003689109.1 hypothetical protein -
  GHB96_RS02500 (GHB96_02620) - 469090..469527 (+) 438 WP_082286881.1 RusA family crossover junction endodeoxyribonuclease -
  GHB96_RS02505 (GHB96_02625) - 469520..469825 (+) 306 WP_047951716.1 DUF1364 domain-containing protein -
  GHB96_RS02510 (GHB96_02630) - 469822..470205 (+) 384 WP_050171029.1 recombination protein NinB -
  GHB96_RS02515 (GHB96_02635) - 470196..470714 (+) 519 WP_003687984.1 HNH endonuclease -
  GHB96_RS02520 (GHB96_02640) - 470779..471201 (+) 423 WP_003690919.1 hypothetical protein -
  GHB96_RS02525 (GHB96_02645) - 471201..471443 (+) 243 WP_003706439.1 hypothetical protein -
  GHB96_RS02530 (GHB96_02650) - 471498..471740 (+) 243 WP_003687989.1 hypothetical protein -
  GHB96_RS02535 (GHB96_02655) - 471721..472995 (+) 1275 WP_010951185.1 PBSX family phage terminase large subunit -
  GHB96_RS02540 (GHB96_02660) - 472980..475247 (+) 2268 WP_225577699.1 hypothetical protein -
  GHB96_RS02545 (GHB96_02665) - 475484..476680 (+) 1197 WP_050171028.1 hypothetical protein -
  GHB96_RS02550 (GHB96_02675) - 476677..483975 (+) 7299 WP_050171027.1 PLxRFG domain-containing protein -
  GHB96_RS02560 (GHB96_02685) - 484601..485896 (+) 1296 WP_047951717.1 DUF4043 family protein -
  GHB96_RS02565 (GHB96_02690) - 485951..486424 (+) 474 WP_003687996.1 hypothetical protein -
  GHB96_RS02570 (GHB96_02695) - 486430..486915 (+) 486 WP_003687997.1 hypothetical protein -
  GHB96_RS02575 (GHB96_02700) - 486912..487586 (+) 675 WP_003687998.1 hypothetical protein -
  GHB96_RS02580 (GHB96_02705) - 487772..488623 (-) 852 WP_050171026.1 Bro-N domain-containing protein -

Sequence


Protein


Download         Length: 311 a.a.        Molecular weight: 34280.23 Da        Isoelectric Point: 9.1731

>NTDB_id=396152 GHB96_RS02315 WP_215772541.1 448653..449588(+) (pilJ) [Neisseria gonorrhoeae strain NG250]
MKRKMLNVPKGGYDGMKGFTIVEFLVAGLLSIIVLIAVVSSYFTSRKLNDAANERLAEQQDLRNAATLIVRDARMAGSFG
CFNMSEHIKDVVVSDVAQKNYLFLLKKSNANKLIPIAESLNINYRGFLQVGSALIFQYGIDDVNASADTTVVSSCAVISK
PGKQILNLEDVKKELKIASQDKEQNGNIARQRHVVNAYAVGRFGNEEGLFRFQLNEKGEWGNPQLLAKKIKRMRVRYIYV
SGCPEDEDAGKEEQFKYTDKFDSSVTPAGVEVLLDSGGSDAKIAASSDNIIYAYRINATIRGGNVCANRTL

Nucleotide


Download         Length: 936 bp        

>NTDB_id=396152 GHB96_RS02315 WP_215772541.1 448653..449588(+) (pilJ) [Neisseria gonorrhoeae strain NG250]
ATGAAACGTAAAATGCTAAACGTACCAAAGGGCGGTTATGATGGTATGAAGGGTTTTACCATTGTTGAATTTCTGGTTGC
GGGCCTGCTCAGTATAATTGTCCTGATAGCGGTCGTATCGAGTTACTTTACATCCCGGAAATTAAATGATGCGGCAAACG
AGCGTCTTGCCGAGCAACAGGATTTGCGGAATGCGGCAACATTGATTGTCCGCGATGCAAGAATGGCGGGGAGCTTCGGT
TGCTTCAATATGTCTGAGCATATCAAAGATGTTGTTGTTTCCGATGTGGCGCAAAAAAACTATCTTTTTTTGTTAAAAAA
GAGCAATGCAAATAAACTTATCCCCATAGCGGAATCTTTAAATATCAATTATCGGGGTTTTCTCCAGGTTGGTAGCGCAT
TGATTTTTCAATACGGAATCGATGATGTTAATGCAAGTGCCGATACTACCGTCGTCAGCAGCTGTGCCGTAATATCGAAA
CCGGGCAAGCAAATCCTTAATTTAGAAGATGTAAAAAAAGAATTGAAGATTGCGAGTCAGGATAAGGAGCAAAATGGCAA
TATAGCGCGTCAAAGGCATGTGGTCAATGCCTATGCGGTCGGCAGGTTTGGCAATGAGGAAGGTTTGTTCCGCTTCCAAT
TGAATGAAAAGGGCGAGTGGGGTAATCCTCAGTTGCTCGCGAAAAAGATTAAACGTATGAGAGTGCGGTATATCTATGTT
TCCGGTTGTCCTGAAGATGAAGATGCCGGCAAAGAGGAACAATTCAAATATACGGATAAATTCGACAGCTCTGTTACGCC
TGCCGGGGTGGAGGTTTTATTGGATAGCGGCGGTAGTGATGCCAAGATTGCCGCTTCTTCAGATAATATTATTTATGCTT
ACCGTATCAATGCGACAATACGCGGGGGAAATGTATGCGCAAACAGAACACTTTGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilJ Neisseria gonorrhoeae MS11

87.58

100

0.884


Multiple sequence alignment