Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   FPL20_RS12170 Genome accession   NZ_CP045478
Coordinates   2302122..2302295 (-) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain JD-014     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2297122..2307295
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FPL20_RS12125 (FPL20_GE02282) comGE 2297473..2297820 (+) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  FPL20_RS12130 (FPL20_GE02283) comGF 2297846..2298229 (+) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  FPL20_RS12135 (FPL20_GE02284) comGG 2298230..2298604 (+) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  FPL20_RS12140 (FPL20_GE02285) spoIITA 2298675..2298854 (+) 180 WP_003230176.1 YqzE family protein -
  FPL20_RS12145 (FPL20_GE02286) yqzG 2298896..2299222 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  FPL20_RS12150 (FPL20_GE02287) tapA 2299494..2300255 (+) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  FPL20_RS12155 (FPL20_GE02288) sipW 2300239..2300811 (+) 573 WP_003246088.1 signal peptidase I SipW -
  FPL20_RS12160 (FPL20_GE02289) tasA 2300875..2301660 (+) 786 WP_004398632.1 biofilm matrix protein TasA -
  FPL20_RS12165 (FPL20_GE02290) sinR 2301753..2302088 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  FPL20_RS12170 (FPL20_GE02291) sinI 2302122..2302295 (-) 174 WP_003230187.1 anti-repressor SinI Regulator
  FPL20_RS12175 (FPL20_GE02292) yqhG 2302478..2303272 (-) 795 WP_003230200.1 YqhG family protein -
  FPL20_RS12180 (FPL20_GE02293) hepAA 2303293..2304966 (-) 1674 WP_004398544.1 DEAD/DEAH box helicase -
  FPL20_RS12185 (FPL20_GE02294) gcvT 2305408..2306496 (+) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=394503 FPL20_RS12170 WP_003230187.1 2302122..2302295(-) (sinI) [Bacillus subtilis strain JD-014]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=394503 FPL20_RS12170 WP_003230187.1 2302122..2302295(-) (sinI) [Bacillus subtilis strain JD-014]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment