Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   FPL20_RS08305 Genome accession   NZ_CP045478
Coordinates   1598737..1598904 (+) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis strain JD-014     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 1593737..1603904
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FPL20_RS08275 (FPL20_GE01559) pncB 1593882..1595354 (+) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  FPL20_RS08280 (FPL20_GE01560) pdeH 1595491..1596720 (+) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  FPL20_RS08285 (FPL20_GE01561) - 1596696..1597064 (-) 369 WP_003243784.1 hypothetical protein -
  FPL20_RS08290 - 1597178..1597303 (-) 126 WP_003228793.1 hypothetical protein -
  FPL20_RS08295 (FPL20_GE01562) degQ 1597525..1597665 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  FPL20_RS08300 (FPL20_GE01563) comQ 1597850..1598749 (+) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  FPL20_RS08305 (FPL20_GE01564) comX 1598737..1598904 (+) 168 WP_003242801.1 competence pheromone ComX Regulator
  FPL20_RS08310 comP 1598919..1601227 (+) 2309 Protein_1599 two-component system sensor histidine kinase ComP -
  FPL20_RS08315 (FPL20_GE01567) comA 1601308..1601952 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  FPL20_RS08320 (FPL20_GE01568) yuxO 1601971..1602351 (+) 381 WP_003228810.1 hotdog fold thioesterase -
  FPL20_RS08325 (FPL20_GE01569) mnhG 1602390..1602764 (-) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  FPL20_RS08330 (FPL20_GE01570) mrpF 1602748..1603032 (-) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  FPL20_RS08335 (FPL20_GE01571) mrpE 1603032..1603508 (-) 477 WP_003244015.1 Na+/H+ antiporter subunit E -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=394480 FPL20_RS08305 WP_003242801.1 1598737..1598904(+) (comX) [Bacillus subtilis strain JD-014]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=394480 FPL20_RS08305 WP_003242801.1 1598737..1598904(+) (comX) [Bacillus subtilis strain JD-014]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment