Detailed information    

insolico Bioinformatically predicted

Overview

Name   scnR   Type   Regulator
Locus tag   GCU39_RS14845 Genome accession   NZ_CP045293
Coordinates   3303713..3304426 (-) Length   237 a.a.
NCBI ID   WP_152394238.1    Uniprot ID   -
Organism   Paenibacillus guangzhouensis strain KCTC 33171     
Function   regulate comX expression (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 3300324..3351570 3303713..3304426 within 0


Gene organization within MGE regions


Location: 3300324..3351570
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GCU39_RS14825 - 3300324..3300737 (-) 414 WP_152394235.1 DUF4183 domain-containing protein -
  GCU39_RS14830 - 3300893..3301177 (-) 285 WP_152394236.1 DUF4183 domain-containing protein -
  GCU39_RS14840 - 3302294..3303712 (-) 1419 WP_152394237.1 sensor histidine kinase KdpD -
  GCU39_RS14845 scnR 3303713..3304426 (-) 714 WP_152394238.1 response regulator transcription factor Regulator
  GCU39_RS14850 - 3304591..3305508 (+) 918 WP_152394239.1 ABC transporter ATP-binding protein -
  GCU39_RS14855 - 3305505..3306257 (+) 753 WP_152394240.1 ABC transporter permease -
  GCU39_RS14860 - 3306270..3307001 (+) 732 WP_152394241.1 ABC transporter permease -
  GCU39_RS14865 - 3307024..3307374 (+) 351 WP_152394242.1 YxeA family protein -
  GCU39_RS14870 - 3307520..3308005 (-) 486 WP_193726932.1 GyrI-like domain-containing protein -
  GCU39_RS14875 - 3308434..3309483 (-) 1050 WP_227793581.1 phosphodiester glycosidase family protein -
  GCU39_RS14880 - 3309887..3310045 (-) 159 Protein_3014 NUDIX domain-containing protein -
  GCU39_RS14885 - 3310119..3310592 (-) 474 WP_152394245.1 NUDIX hydrolase -
  GCU39_RS14890 - 3310686..3311549 (-) 864 WP_193726933.1 hypothetical protein -
  GCU39_RS14895 - 3311742..3312647 (+) 906 WP_193726934.1 copper amine oxidase N-terminal domain-containing protein -
  GCU39_RS14900 - 3312748..3313161 (-) 414 WP_407671715.1 VOC family protein -
  GCU39_RS14905 - 3313251..3314627 (-) 1377 WP_193726935.1 helix-turn-helix domain-containing protein -
  GCU39_RS14910 - 3315092..3317083 (+) 1992 WP_152394249.1 serine hydrolase -
  GCU39_RS14915 - 3317391..3317603 (-) 213 WP_152394250.1 hypothetical protein -
  GCU39_RS14920 - 3317606..3318844 (-) 1239 WP_227793582.1 cell wall metabolism sensor histidine kinase WalK -
  GCU39_RS14925 - 3319003..3319668 (-) 666 WP_265333543.1 response regulator transcription factor -
  GCU39_RS14930 - 3320166..3320366 (-) 201 WP_152394253.1 DUF2933 domain-containing protein -
  GCU39_RS14935 - 3320593..3320850 (-) 258 WP_152394254.1 hypothetical protein -
  GCU39_RS14940 - 3320918..3321220 (-) 303 WP_152394255.1 NusG domain II-containing protein -
  GCU39_RS31980 - 3321217..3321384 (-) 168 WP_265333524.1 hypothetical protein -
  GCU39_RS31985 - 3321464..3321868 (-) 405 WP_227793583.1 prolipoprotein diacylglyceryl transferase -
  GCU39_RS14950 - 3322149..3323771 (-) 1623 WP_152394256.1 multicopper oxidase family protein -
  GCU39_RS14955 - 3324259..3325410 (-) 1152 WP_152394257.1 cell wall metabolism sensor histidine kinase WalK -
  GCU39_RS14960 - 3325407..3326093 (-) 687 WP_152394258.1 response regulator transcription factor -
  GCU39_RS14965 - 3326265..3326657 (+) 393 WP_152394259.1 DUF6223 family protein -
  GCU39_RS14970 - 3326731..3327132 (+) 402 WP_152394260.1 DUF6223 family protein -
  GCU39_RS32535 - 3327243..3327329 (+) 87 Protein_3034 hypothetical protein -
  GCU39_RS32540 - 3327352..3327399 (-) 48 Protein_3035 hypothetical protein -
  GCU39_RS14980 - 3327557..3327949 (+) 393 WP_152394261.1 DUF6223 family protein -
  GCU39_RS14985 - 3328314..3328625 (+) 312 WP_227793584.1 DUF6223 family protein -
  GCU39_RS14990 - 3328846..3330300 (+) 1455 WP_152394262.1 carboxylic ester hydrolase -
  GCU39_RS14995 - 3330854..3332161 (-) 1308 WP_193726937.1 ABC transporter substrate-binding protein -
  GCU39_RS15000 - 3332176..3333333 (-) 1158 WP_152394264.1 efflux RND transporter periplasmic adaptor subunit -
  GCU39_RS15005 - 3333345..3334211 (-) 867 WP_152394265.1 carbohydrate ABC transporter permease -
  GCU39_RS15010 - 3334226..3335101 (-) 876 WP_152394266.1 carbohydrate ABC transporter permease -
  GCU39_RS15015 - 3335247..3336743 (-) 1497 WP_152394267.1 HAMP domain-containing sensor histidine kinase -
  GCU39_RS15020 - 3336736..3337395 (-) 660 WP_152394268.1 response regulator transcription factor -
  GCU39_RS15025 - 3337695..3337898 (-) 204 WP_152394269.1 zinc ribbon domain-containing protein -
  GCU39_RS15030 - 3338042..3338266 (-) 225 WP_152394270.1 hypothetical protein -
  GCU39_RS15035 - 3338405..3338671 (-) 267 WP_152394271.1 DUF1871 family protein -
  GCU39_RS15040 - 3338897..3339448 (-) 552 WP_152394272.1 GNAT family N-acetyltransferase -
  GCU39_RS15045 - 3339454..3340083 (-) 630 WP_152394273.1 TetR family transcriptional regulator -
  GCU39_RS32000 - 3340290..3340673 (-) 384 WP_265333544.1 group II intron maturase-specific domain-containing protein -
  GCU39_RS32005 - 3340798..3341247 (-) 450 WP_227793586.1 hypothetical protein -
  GCU39_RS15055 - 3342110..3342526 (+) 417 WP_152394274.1 VOC family protein -
  GCU39_RS15060 - 3342675..3342881 (-) 207 WP_152394275.1 DUF1657 domain-containing protein -
  GCU39_RS15065 - 3343195..3343911 (-) 717 WP_152394276.1 glycosyltransferase family 2 protein -
  GCU39_RS15070 - 3344245..3344787 (+) 543 WP_152394277.1 hypothetical protein -
  GCU39_RS15075 - 3344896..3345402 (-) 507 WP_152394278.1 DNA topology modulation protein FlaR -
  GCU39_RS15080 - 3345680..3346480 (-) 801 WP_152394279.1 helix-turn-helix domain-containing protein -
  GCU39_RS15085 - 3346661..3347188 (-) 528 WP_152394280.1 hypothetical protein -
  GCU39_RS15090 - 3347296..3347829 (-) 534 WP_152394281.1 RDD family protein -
  GCU39_RS31535 - 3348025..3348171 (-) 147 WP_193726938.1 hypothetical protein -
  GCU39_RS15095 - 3348492..3349199 (-) 708 WP_152394282.1 carboxylesterase -
  GCU39_RS15100 - 3349360..3350736 (-) 1377 WP_152394283.1 protein-lysine N-methyltransferase -

Sequence

Protein


Download         Length: 237 a.a.        Molecular weight: 26999.54 Da        Isoelectric Point: 6.0441

>NTDB_id=393159 GCU39_RS14845 WP_152394238.1 3303713..3304426(-) (scnR) [Paenibacillus guangzhouensis strain KCTC 33171]
MENLKDKKILIVDDEPEIRIMIERFLRKEGFFRIFTAADCASALSICHTGKPDIVILDVMLPDGDGFSLLSSIRQFSETP
ILFLSARGEDEDRLLGLGLGADDYIVKPFLPRELVLRLMVILKRVFSSPVVERLSAFRLGEQIIDLDSAVVHRNDKELPL
TAKEHAILVKLYENQNRIVTSDALCQAVWGDDSYGYENTLMVHIRRVREKIELDPSKPIHLLTVRGLGYKLLVKEIR

Nucleotide


Download         Length: 714 bp        

>NTDB_id=393159 GCU39_RS14845 WP_152394238.1 3303713..3304426(-) (scnR) [Paenibacillus guangzhouensis strain KCTC 33171]
ATGGAAAATTTAAAAGACAAAAAAATATTAATTGTAGATGATGAACCGGAAATCAGAATTATGATAGAAAGATTTTTAAG
AAAAGAGGGATTTTTCCGCATTTTCACAGCAGCCGACTGTGCTTCAGCTCTATCGATCTGCCACACAGGCAAGCCGGATA
TCGTGATTCTCGATGTCATGCTGCCTGATGGCGATGGATTCTCGCTTCTGTCTTCCATTAGACAGTTCTCGGAAACTCCT
ATTCTTTTTCTCTCCGCGCGGGGTGAGGATGAAGACCGATTGCTTGGACTAGGTTTGGGGGCAGATGATTACATTGTGAA
GCCGTTTCTACCGCGGGAGCTGGTATTACGGCTTATGGTAATACTAAAGCGGGTCTTCTCCTCTCCCGTGGTGGAGCGCT
TGTCTGCTTTTCGATTGGGAGAACAAATCATTGATCTGGATAGCGCTGTTGTGCACAGGAATGATAAAGAGCTGCCATTG
ACGGCAAAGGAACATGCGATTCTTGTAAAGTTGTACGAAAACCAGAATCGCATTGTCACAAGTGACGCCTTATGTCAGGC
CGTTTGGGGAGATGACAGCTACGGATATGAAAATACATTAATGGTCCATATCAGGCGGGTACGTGAAAAAATCGAGCTCG
ATCCCTCCAAACCGATCCATCTTCTCACCGTCAGAGGACTGGGATATAAGTTGCTGGTGAAGGAGATACGTTAA

Domains

Predicted by InterproScan.

Transcriptional regulatory protein, C terminal (Trans_reg_C)

(156-231)

Response regulator receiver domain (Response_reg)

(9-117)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  scnR Streptococcus mutans UA159

49.351

97.468

0.481
  micA Streptococcus pneumoniae Cp1015

40.87

97.046

0.397
  vicR Streptococcus mutans UA159

40.693

97.468

0.397

Multiple sequence alignment