Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | D5R78_RS04535 | Genome accession | NZ_CP045187 |
| Coordinates | 946817..947215 (+) | Length | 132 a.a. |
| NCBI ID | WP_011275249.1 | Uniprot ID | A0A5B2YX53 |
| Organism | Staphylococcus haemolyticus strain VB19458 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 946186..983736 | 946817..947215 | within | 0 |
Gene organization within MGE regions
Location: 946186..983736
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D5R78_RS04530 (D5R78_010055) | - | 946186..946629 (-) | 444 | WP_011275248.1 | YwpF-like family protein | - |
| D5R78_RS04535 (D5R78_010050) | ssb | 946817..947215 (+) | 399 | WP_011275249.1 | single-stranded DNA-binding protein | Machinery gene |
| D5R78_RS04540 (D5R78_010045) | - | 947554..948261 (+) | 708 | WP_011275250.1 | transglycosylase family protein | - |
| D5R78_RS04545 (D5R78_010040) | tenA | 948549..949238 (+) | 690 | WP_011275251.1 | thiaminase II | - |
| D5R78_RS04550 (D5R78_010035) | thiD | 949231..950052 (+) | 822 | WP_119880988.1 | bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase | - |
| D5R78_RS04555 (D5R78_010030) | thiM | 950045..950836 (+) | 792 | WP_011275253.1 | hydroxyethylthiazole kinase | - |
| D5R78_RS04560 (D5R78_010025) | thiE | 950838..951476 (+) | 639 | WP_011275254.1 | thiamine phosphate synthase | - |
| D5R78_RS04565 (D5R78_010020) | yidC | 951565..952440 (+) | 876 | WP_011275255.1 | membrane protein insertase YidC | - |
| D5R78_RS04570 (D5R78_010015) | - | 952635..953947 (+) | 1313 | Protein_924 | ISL3 family transposase | - |
| D5R78_RS04575 (D5R78_010010) | - | 953994..954635 (-) | 642 | WP_119881121.1 | HD domain-containing protein | - |
| D5R78_RS04580 (D5R78_010005) | cls | 954735..956219 (-) | 1485 | WP_119881119.1 | cardiolipin synthase | - |
| D5R78_RS04585 (D5R78_010000) | csoR | 956376..956699 (+) | 324 | WP_046309851.1 | copper-sensing transcriptional repressor CsoR | - |
| D5R78_RS04590 (D5R78_009995) | csoZ | 956711..956917 (+) | 207 | WP_011275259.1 | putative copper chaperone CsoZ | - |
| D5R78_RS04595 (D5R78_009990) | - | 957025..957162 (+) | 138 | WP_011275260.1 | Lmo0850 family protein | - |
| D5R78_RS04600 (D5R78_009985) | - | 957459..959124 (+) | 1666 | Protein_930 | IS1182 family transposase | - |
| D5R78_RS04605 (D5R78_009980) | - | 959099..960298 (-) | 1200 | WP_119881069.1 | FtsW/RodA/SpoVE family cell cycle protein | - |
| D5R78_RS04610 (D5R78_009975) | - | 960716..961786 (+) | 1071 | WP_011275263.1 | D-alanine--D-alanine ligase | - |
| D5R78_RS04615 (D5R78_009970) | - | 961802..963157 (+) | 1356 | WP_011275264.1 | UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase | - |
| D5R78_RS04620 (D5R78_009965) | cshA | 963428..964939 (+) | 1512 | WP_016931362.1 | degradosome RNA helicase CshA | - |
| D5R78_RS04625 (D5R78_009960) | - | 965105..965584 (+) | 480 | WP_011275266.1 | PH domain-containing protein | - |
| D5R78_RS04630 (D5R78_009955) | - | 965577..967100 (+) | 1524 | WP_016931363.1 | PH domain-containing protein | - |
| D5R78_RS04635 (D5R78_009950) | - | 967093..967620 (+) | 528 | WP_033080076.1 | PH domain-containing protein | - |
| D5R78_RS04640 (D5R78_009945) | acpS | 967630..967989 (+) | 360 | WP_011275269.1 | holo-ACP synthase | - |
| D5R78_RS04645 (D5R78_009940) | alr | 968085..969233 (+) | 1149 | WP_016931365.1 | alanine racemase | - |
| D5R78_RS04650 (D5R78_009935) | mazE | 969319..969489 (+) | 171 | WP_011275271.1 | type II toxin-antitoxin system antitoxin MazE | - |
| D5R78_RS04655 (D5R78_009930) | - | 969486..969851 (+) | 366 | WP_011275272.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| D5R78_RS04660 (D5R78_009925) | - | 970159..971160 (+) | 1002 | WP_011275273.1 | SpoIIE family protein phosphatase | - |
| D5R78_RS04665 (D5R78_009920) | - | 971259..971585 (+) | 327 | WP_011275274.1 | anti-sigma factor antagonist | - |
| D5R78_RS04670 (D5R78_009915) | rsbW | 971614..972066 (+) | 453 | WP_046309853.1 | anti-sigma B factor RsbW | - |
| D5R78_RS04675 (D5R78_009910) | sigB | 972041..972811 (+) | 771 | WP_011275276.1 | RNA polymerase sigma factor SigB | - |
| D5R78_RS04680 (D5R78_009905) | - | 973061..975208 (+) | 2148 | WP_016931366.1 | Tex family protein | - |
| D5R78_RS04685 (D5R78_009900) | - | 975201..975656 (+) | 456 | WP_016931367.1 | SprT family protein | - |
| D5R78_RS04715 (D5R78_009870) | - | 982032..983695 (+) | 1664 | Protein_948 | IS1182 family transposase | - |
Sequence
Protein
Download Length: 132 a.a. Molecular weight: 15141.05 Da Isoelectric Point: 4.7942
>NTDB_id=392511 D5R78_RS04535 WP_011275249.1 946817..947215(+) (ssb) [Staphylococcus haemolyticus strain VB19458]
MLNKIVIVGRLTKKAQIFENEEVKIATFCVATERNYKDENNEIACDYIFCKAFGKTATNIESYTDQGTLVGITGQMRSRK
YDKDGQTHFVTELYVETIKFMSPKSKNDNILPNTSYDEDAYSFDHLEVIDVN
MLNKIVIVGRLTKKAQIFENEEVKIATFCVATERNYKDENNEIACDYIFCKAFGKTATNIESYTDQGTLVGITGQMRSRK
YDKDGQTHFVTELYVETIKFMSPKSKNDNILPNTSYDEDAYSFDHLEVIDVN
Nucleotide
Download Length: 399 bp
>NTDB_id=392511 D5R78_RS04535 WP_011275249.1 946817..947215(+) (ssb) [Staphylococcus haemolyticus strain VB19458]
ATGCTAAATAAAATTGTGATAGTAGGTCGATTGACCAAAAAGGCACAAATATTTGAAAACGAGGAGGTGAAAATAGCTAC
GTTCTGTGTTGCAACTGAACGTAATTATAAAGATGAAAATAATGAAATAGCTTGTGATTATATTTTTTGTAAGGCATTTG
GTAAAACAGCAACAAATATAGAATCATATACAGACCAAGGCACTTTAGTTGGTATTACAGGACAAATGAGATCTCGTAAG
TACGATAAAGATGGCCAAACGCACTTTGTGACTGAATTATATGTTGAAACAATTAAATTTATGTCCCCTAAATCTAAAAA
TGATAATATTCTTCCTAACACCTCATATGATGAAGACGCTTATTCCTTTGATCACCTTGAAGTGATTGATGTTAACTAA
ATGCTAAATAAAATTGTGATAGTAGGTCGATTGACCAAAAAGGCACAAATATTTGAAAACGAGGAGGTGAAAATAGCTAC
GTTCTGTGTTGCAACTGAACGTAATTATAAAGATGAAAATAATGAAATAGCTTGTGATTATATTTTTTGTAAGGCATTTG
GTAAAACAGCAACAAATATAGAATCATATACAGACCAAGGCACTTTAGTTGGTATTACAGGACAAATGAGATCTCGTAAG
TACGATAAAGATGGCCAAACGCACTTTGTGACTGAATTATATGTTGAAACAATTAAATTTATGTCCCCTAAATCTAAAAA
TGATAATATTCTTCCTAACACCTCATATGATGAAGACGCTTATTCCTTTGATCACCTTGAAGTGATTGATGTTAACTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Staphylococcus aureus N315 |
75.573 |
99.242 |
0.75 |
| ssb | Staphylococcus aureus MW2 |
74.809 |
99.242 |
0.742 |