Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinR   Type   Regulator
Locus tag   HNO12_RS15465 Genome accession   NZ_CP053376
Coordinates   3180689..3180895 (-) Length   68 a.a.
NCBI ID   WP_083058957.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain WF02     
Function   repression of rok; repression of degU; repression of spo0A (predicted from homology)   
Competence regulation

Genomic Context

Location: 3175689..3185895
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HNO12_RS15400 (HNO12_15445) - 3175791..3176045 (-) 255 WP_083058940.1 hypothetical protein -
  HNO12_RS15405 (HNO12_15450) - 3176042..3176449 (-) 408 WP_083058938.1 hypothetical protein -
  HNO12_RS15410 (HNO12_15455) - 3176446..3176826 (-) 381 WP_083058937.1 hypothetical protein -
  HNO12_RS15415 (HNO12_15460) - 3176967..3177170 (-) 204 WP_024085436.1 XtrA/YqaO family protein -
  HNO12_RS15420 (HNO12_15465) - 3177250..3177405 (-) 156 WP_165869032.1 hypothetical protein -
  HNO12_RS15425 (HNO12_15470) - 3177418..3177558 (-) 141 WP_015387918.1 BH0509 family protein -
  HNO12_RS15430 (HNO12_15475) - 3177666..3178214 (-) 549 WP_083058934.1 hypothetical protein -
  HNO12_RS15435 (HNO12_15480) - 3178211..3178369 (-) 159 WP_165869033.1 hypothetical protein -
  HNO12_RS15440 (HNO12_15485) - 3178366..3178515 (-) 150 WP_165869034.1 type VI secretion system contractile sheath protein TssC -
  HNO12_RS15445 (HNO12_15490) - 3178530..3179420 (-) 891 WP_228842152.1 ATP-binding protein -
  HNO12_RS15450 (HNO12_15495) - 3179347..3180225 (-) 879 WP_083058933.1 conserved phage C-terminal domain-containing protein -
  HNO12_RS15455 (HNO12_15500) - 3180218..3180448 (-) 231 WP_083058930.1 hypothetical protein -
  HNO12_RS15460 (HNO12_15505) - 3180417..3180647 (-) 231 WP_083058928.1 hypothetical protein -
  HNO12_RS15465 (HNO12_15510) sinR 3180689..3180895 (-) 207 WP_083058957.1 helix-turn-helix transcriptional regulator Regulator
  HNO12_RS15470 (HNO12_15515) - 3181070..3181459 (+) 390 WP_083058926.1 helix-turn-helix transcriptional regulator -
  HNO12_RS15475 (HNO12_15520) - 3181687..3181884 (-) 198 WP_083058924.1 hypothetical protein -
  HNO12_RS15480 (HNO12_15525) - 3181881..3183005 (-) 1125 WP_083058922.1 AimR family lysis-lysogeny pheromone receptor -
  HNO12_RS15485 (HNO12_15530) - 3183282..3184319 (+) 1038 WP_083058920.1 tyrosine-type recombinase/integrase -
  HNO12_RS15490 (HNO12_15535) sufB 3184391..3185788 (-) 1398 WP_003151878.1 Fe-S cluster assembly protein SufB -

Sequence

Protein


Download         Length: 68 a.a.        Molecular weight: 7744.10 Da        Isoelectric Point: 10.2474

>NTDB_id=391882 HNO12_RS15465 WP_083058957.1 3180689..3180895(-) (sinR) [Bacillus amyloliquefaciens strain WF02]
MLTNKTIGDIIKQIRKEAKLTQKEFSCKLGVSDSYISKVEKNKSYPSLKFLKNVSDKLDKPMGIFFGD

Nucleotide


Download         Length: 207 bp        

>NTDB_id=391882 HNO12_RS15465 WP_083058957.1 3180689..3180895(-) (sinR) [Bacillus amyloliquefaciens strain WF02]
ATTCTGACTAACAAAACCATAGGGGATATTATTAAGCAAATACGCAAAGAAGCAAAACTAACACAAAAAGAATTTTCTTG
TAAACTCGGTGTATCAGACTCCTATATCAGTAAGGTTGAAAAGAATAAATCGTATCCAAGTTTAAAATTCTTGAAGAATG
TCTCCGATAAATTAGATAAACCCATGGGTATTTTTTTTGGAGACTAA

Domains

Predicted by InterProScan.

Helix-turn-helix (HTH_3)

(11-63)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinR Bacillus subtilis subsp. subtilis str. 168

46.296

79.412

0.368

Multiple sequence alignment