Detailed information    

insolico Bioinformatically predicted

Overview

Name   CJE0566   Type   Regulator
Locus tag   F1716_RS03135 Genome accession   NZ_CP045048
Coordinates   517163..517813 (-) Length   216 a.a.
NCBI ID   WP_153257479.1    Uniprot ID   -
Organism   Campylobacter jejuni subsp. jejuni strain NADC 20827     
Function   repress natural transformation (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 501223..534658 517163..517813 within 0


Gene organization within MGE regions


Location: 501223..534658
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  F1716_RS02995 (F1716_03020) - 501223..502200 (+) 978 WP_224374493.1 site-specific integrase -
  F1716_RS03000 (F1716_03025) - 502197..502367 (-) 171 WP_002873564.1 helix-turn-helix domain-containing protein -
  F1716_RS03005 (F1716_03030) - 502360..502902 (-) 543 WP_052795885.1 pentapeptide repeat-containing protein -
  F1716_RS03010 (F1716_03035) - 502904..503572 (-) 669 WP_052795884.1 antA/AntB antirepressor family protein -
  F1716_RS09830 - 503719..503880 (-) 162 WP_002900937.1 hypothetical protein -
  F1716_RS03015 (F1716_03040) - 503901..504788 (-) 888 WP_052795883.1 hypothetical protein -
  F1716_RS10055 - 504763..505341 (-) 579 WP_224374474.1 hypothetical protein -
  F1716_RS10060 - 505486..505965 (-) 480 WP_002873569.1 helix-turn-helix transcriptional regulator -
  F1716_RS03035 (F1716_03060) - 505965..506996 (-) 1032 WP_070313912.1 RelA/SpoT domain-containing protein -
  F1716_RS03040 (F1716_03065) - 507034..507270 (-) 237 WP_002873571.1 hypothetical protein -
  F1716_RS03045 (F1716_03070) - 507280..507573 (-) 294 WP_038401075.1 hypothetical protein -
  F1716_RS03050 (F1716_03075) - 507584..508423 (-) 840 WP_002861640.1 hypothetical protein -
  F1716_RS03055 (F1716_03080) - 508521..508733 (-) 213 WP_052795882.1 hypothetical protein -
  F1716_RS03060 (F1716_03085) - 508746..509030 (-) 285 WP_052795881.1 hypothetical protein -
  F1716_RS03065 (F1716_03090) - 509011..509676 (-) 666 WP_052795880.1 hypothetical protein -
  F1716_RS03070 (F1716_03095) - 509707..510444 (-) 738 WP_052795879.1 hypothetical protein -
  F1716_RS10265 - 510589..510711 (-) 123 WP_257076304.1 hypothetical protein -
  F1716_RS03075 (F1716_03100) - 511220..511444 (-) 225 WP_052795878.1 helix-turn-helix transcriptional regulator -
  F1716_RS03080 (F1716_03105) - 511446..511661 (-) 216 WP_002783970.1 hypothetical protein -
  F1716_RS03085 (F1716_03110) - 511710..512564 (-) 855 WP_070317306.1 lambda-exonuclease family protein -
  F1716_RS03090 (F1716_03115) - 512554..513297 (-) 744 WP_002871209.1 phage regulatory protein/antirepressor Ant -
  F1716_RS03095 (F1716_03120) - 513294..513476 (-) 183 WP_002795990.1 hypothetical protein -
  F1716_RS03100 (F1716_03125) - 513619..513816 (+) 198 WP_002810107.1 hypothetical protein -
  F1716_RS09835 - 513809..513961 (-) 153 WP_002871210.1 hypothetical protein -
  F1716_RS03105 (F1716_03130) - 513958..514212 (-) 255 WP_052798817.1 hypothetical protein -
  F1716_RS03110 (F1716_03135) - 514203..514472 (-) 270 WP_002874357.1 hypothetical protein -
  F1716_RS03115 (F1716_03140) - 515268..515540 (-) 273 WP_070317305.1 hypothetical protein -
  F1716_RS09840 - 515592..515732 (+) 141 WP_002881938.1 hypothetical protein -
  F1716_RS03120 (F1716_03145) - 515722..515913 (-) 192 WP_070275116.1 hypothetical protein -
  F1716_RS03125 (F1716_03150) - 516055..516312 (+) 258 WP_048818571.1 hypothetical protein -
  F1716_RS03130 (F1716_03155) - 516346..517170 (-) 825 WP_002874362.1 hypothetical protein -
  F1716_RS03135 (F1716_03160) CJE0566 517163..517813 (-) 651 WP_153257479.1 DNA/RNA non-specific endonuclease Regulator
  F1716_RS03140 (F1716_03165) - 517829..518332 (-) 504 WP_002865051.1 hypothetical protein -
  F1716_RS03145 (F1716_03170) - 518319..519524 (-) 1206 WP_070317303.1 AAA family ATPase -
  F1716_RS03150 (F1716_03175) - 519627..520361 (-) 735 WP_070317302.1 S24 family peptidase -
  F1716_RS03155 (F1716_03180) - 520474..520692 (+) 219 WP_002826741.1 hypothetical protein -
  F1716_RS09845 (F1716_03185) - 520798..521097 (+) 300 WP_002861657.1 hypothetical protein -
  F1716_RS03165 (F1716_03190) - 521094..522095 (+) 1002 WP_070317301.1 hypothetical protein -
  F1716_RS03170 (F1716_03195) - 522106..522756 (+) 651 WP_002861659.1 hypothetical protein -
  F1716_RS03175 (F1716_03200) - 522774..523154 (+) 381 WP_002788333.1 hypothetical protein -
  F1716_RS03180 (F1716_03205) - 523154..523540 (+) 387 WP_002861661.1 terminase small subunit -
  F1716_RS03185 (F1716_03210) - 523537..524829 (+) 1293 WP_052795874.1 terminase family protein -
  F1716_RS03190 (F1716_03215) - 524819..525091 (+) 273 WP_002781524.1 hypothetical protein -
  F1716_RS03195 (F1716_03220) - 525072..526610 (+) 1539 WP_070317299.1 hypothetical protein -
  F1716_RS03200 (F1716_03225) - 526603..526806 (+) 204 WP_052795872.1 hypothetical protein -
  F1716_RS03205 (F1716_03230) - 526796..527443 (+) 648 WP_002784021.1 hypothetical protein -
  F1716_RS03210 (F1716_03235) - 527454..527834 (+) 381 WP_032582824.1 hypothetical protein -
  F1716_RS03215 (F1716_03240) - 528094..529309 (+) 1216 Protein_567 hypothetical protein -
  F1716_RS03220 (F1716_03245) - 529306..532514 (+) 3209 Protein_568 hypothetical protein -
  F1716_RS03225 (F1716_03250) - 532608..533054 (-) 447 WP_002846375.1 hypothetical protein -
  F1716_RS09850 - 533023..533199 (-) 177 WP_002846376.1 hypothetical protein -
  F1716_RS03230 (F1716_03255) - 533211..533396 (-) 186 WP_002901436.1 hypothetical protein -
  F1716_RS03235 (F1716_03260) - 533624..534658 (+) 1035 WP_011049719.1 DUF5309 family protein -

Sequence

Protein


Download         Length: 216 a.a.        Molecular weight: 25454.06 Da        Isoelectric Point: 9.9285

>NTDB_id=391490 F1716_RS03135 WP_153257479.1 517163..517813(-) (CJE0566) [Campylobacter jejuni subsp. jejuni strain NADC 20827]
MKKLIILSLLTTLALADYSQYKPSEDFTKHFTKQNCSQVLDKFYYLNCYDYNLKGTKAVAYKLEAENLKGEQIKKRPRFE
DDTNIPKKYRTTWSDYKNSGYDREHTISNASMRKTTQAQRSTFLMSNITPQNPQINQKVWNKIEKRERQVALKLGEIEVL
NLVNYDSNPQRIRNQIAIPSSYIKIIKGNNFKECYKVPNYEVDNLSIKRYKFNCDG

Nucleotide


Download         Length: 651 bp        

>NTDB_id=391490 F1716_RS03135 WP_153257479.1 517163..517813(-) (CJE0566) [Campylobacter jejuni subsp. jejuni strain NADC 20827]
ATGAAAAAACTTATAATCTTATCATTATTGACAACTCTAGCCTTAGCTGATTATAGCCAATACAAACCAAGTGAAGATTT
TACTAAGCATTTTACTAAGCAAAACTGCTCACAAGTTTTGGATAAGTTTTATTATCTAAATTGTTATGATTATAATCTTA
AAGGCACTAAAGCTGTAGCTTATAAACTAGAAGCGGAAAATCTAAAAGGCGAACAAATCAAAAAACGCCCACGCTTTGAA
GATGATACAAATATACCTAAAAAATACCGCACCACATGGAGTGATTATAAAAACAGCGGTTATGATAGAGAGCATACTAT
TTCTAATGCTTCAATGAGAAAAACAACTCAAGCCCAAAGAAGCACTTTTTTAATGAGTAATATTACTCCGCAAAATCCAC
AAATTAATCAAAAAGTATGGAATAAGATTGAAAAAAGAGAAAGACAAGTAGCTTTAAAGCTTGGAGAAATTGAAGTTTTA
AATTTGGTTAATTATGATAGCAACCCTCAAAGAATAAGAAATCAAATTGCTATTCCAAGCTCTTATATCAAGATTATAAA
AGGTAATAATTTTAAAGAATGCTATAAAGTTCCAAATTATGAAGTCGATAATTTAAGTATAAAAAGATATAAGTTTAATT
GTGATGGATAA

Domains

Predicted by InterproScan.

DNA/RNA non-specific endonuclease (Endonuclease_NS)

(25-209)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  CJE0566 Campylobacter jejuni RM1221

86.047

99.537

0.856
  CJE1441 Campylobacter jejuni RM1221

85.581

99.537

0.852

Multiple sequence alignment