Detailed information    

insolico Bioinformatically predicted

Overview


Name   CJE1441   Type   Regulator
Locus tag   F1716_RS02055 Genome accession   NZ_CP045048
Coordinates   330985..331626 (-) Length   213 a.a.
NCBI ID   WP_153257473.1    Uniprot ID   -
Organism   Campylobacter jejuni subsp. jejuni strain NADC 20827     
Function   repress natural transformation (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 306334..347617 330985..331626 within 0


Gene organization within MGE regions


Location: 306334..347617
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  F1716_RS01900 (F1716_01915) - 306334..306684 (+) 351 WP_002869973.1 HNH endonuclease signature motif containing protein -
  F1716_RS01905 (F1716_01920) - 306935..307573 (+) 639 WP_002913306.1 P27 family phage terminase small subunit -
  F1716_RS01910 (F1716_01925) - 307577..309202 (+) 1626 WP_002913304.1 terminase TerL endonuclease subunit -
  F1716_RS01915 (F1716_01930) - 309257..309691 (+) 435 WP_002913302.1 type II toxin-antitoxin system PemK/MazF family toxin -
  F1716_RS01920 (F1716_01935) - 309851..311023 (+) 1173 WP_002788272.1 phage portal protein -
  F1716_RS01925 (F1716_01940) - 311020..311562 (+) 543 WP_002800770.1 HK97 gp10 family phage protein -
  F1716_RS01930 (F1716_01945) - 311563..311913 (+) 351 WP_002788276.1 hypothetical protein -
  F1716_RS01935 (F1716_01950) - 311901..312164 (-) 264 WP_002869971.1 type II toxin-antitoxin system RelE/ParE family toxin -
  F1716_RS01940 (F1716_01955) - 312161..312385 (-) 225 WP_002869970.1 DUF6290 family protein -
  F1716_RS01945 (F1716_01960) - 312532..313512 (+) 981 WP_002800772.1 hypothetical protein -
  F1716_RS01950 (F1716_01965) - 313509..313865 (+) 357 WP_002788281.1 hypothetical protein -
  F1716_RS01955 (F1716_01970) - 313946..314161 (+) 216 WP_002788282.1 hypothetical protein -
  F1716_RS01960 (F1716_01975) - 314153..314491 (-) 339 WP_002788283.1 hypothetical protein -
  F1716_RS01965 (F1716_01980) - 314551..320277 (+) 5727 WP_002800774.1 hypothetical protein -
  F1716_RS01970 (F1716_01985) - 320290..321159 (+) 870 WP_002788286.1 hypothetical protein -
  F1716_RS01975 (F1716_01990) - 321245..321802 (+) 558 WP_002788287.1 HK97 family phage prohead protease -
  F1716_RS01980 (F1716_01995) - 321819..322985 (+) 1167 WP_002788288.1 phage major capsid protein -
  F1716_RS01985 (F1716_02000) - 322996..323247 (+) 252 WP_153257467.1 hypothetical protein -
  F1716_RS01990 (F1716_02005) - 323244..323681 (+) 438 WP_002788293.1 phage gp6-like head-tail connector protein -
  F1716_RS01995 (F1716_02010) - 323694..324011 (+) 318 WP_153257468.1 head-tail adaptor protein -
  F1716_RS02000 (F1716_02015) - 324008..324640 (+) 633 WP_002788297.1 hypothetical protein -
  F1716_RS02005 (F1716_02020) - 324633..326198 (+) 1566 WP_153257469.1 hypothetical protein -
  F1716_RS02010 (F1716_02025) - 326200..326649 (+) 450 WP_153257470.1 hypothetical protein -
  F1716_RS02015 (F1716_02030) - 326662..327297 (+) 636 WP_057030888.1 DUF4376 domain-containing protein -
  F1716_RS02020 (F1716_02035) - 327294..327758 (+) 465 WP_002801917.1 hypothetical protein -
  F1716_RS02025 (F1716_02040) - 327748..328119 (+) 372 WP_002801918.1 DUF1353 domain-containing protein -
  F1716_RS02030 (F1716_02045) - 328116..329399 (+) 1284 WP_057981351.1 hypothetical protein -
  F1716_RS02035 (F1716_02050) - 329448..329909 (+) 462 WP_153257471.1 DUF5675 family protein -
  F1716_RS02040 (F1716_02055) - 330139..330558 (+) 420 WP_153257472.1 hypothetical protein -
  F1716_RS02045 (F1716_02060) - 330476..330673 (+) 198 WP_002913413.1 hypothetical protein -
  F1716_RS02050 (F1716_02065) - 330687..330968 (-) 282 WP_002870263.1 PLDc N-terminal domain-containing protein -
  F1716_RS02055 (F1716_02070) CJE1441 330985..331626 (-) 642 WP_153257473.1 DNA/RNA non-specific endonuclease Regulator
  F1716_RS02060 (F1716_02075) - 331632..332294 (-) 663 WP_002870274.1 S24/S26 family peptidase -
  F1716_RS02065 (F1716_02080) - 332529..333182 (-) 654 WP_002870336.1 hypothetical protein -
  F1716_RS02070 (F1716_02085) - 333387..333590 (+) 204 WP_002870299.1 hypothetical protein -
  F1716_RS02075 (F1716_02090) - 333587..333871 (+) 285 WP_153257474.1 hypothetical protein -
  F1716_RS02080 (F1716_02095) - 334302..335033 (+) 732 WP_153257475.1 phage regulatory protein/antirepressor Ant -
  F1716_RS02085 (F1716_02100) - 335086..335373 (+) 288 WP_002787279.1 YopX family protein -
  F1716_RS02090 (F1716_02105) - 335430..335693 (+) 264 WP_002787281.1 hypothetical protein -
  F1716_RS02095 (F1716_02110) - 335659..335889 (+) 231 WP_002787283.1 hypothetical protein -
  F1716_RS02100 (F1716_02115) - 336027..336794 (+) 768 WP_002787287.1 hypothetical protein -
  F1716_RS02105 (F1716_02120) - 336808..337044 (+) 237 WP_002787289.1 hypothetical protein -
  F1716_RS02110 (F1716_02125) - 337432..337752 (+) 321 WP_002787293.1 hypothetical protein -
  F1716_RS02115 (F1716_02130) - 337831..338145 (+) 315 WP_153257476.1 hypothetical protein -
  F1716_RS02120 (F1716_02135) - 338082..338843 (+) 762 WP_153257477.1 hypothetical protein -
  F1716_RS02125 (F1716_02140) - 338852..339076 (+) 225 WP_002787300.1 hypothetical protein -
  F1716_RS02130 (F1716_02145) - 339077..339448 (+) 372 WP_002858334.1 hypothetical protein -
  F1716_RS02135 (F1716_02150) - 339432..339698 (+) 267 WP_002787304.1 hypothetical protein -
  F1716_RS02140 (F1716_02155) - 339676..340431 (+) 756 WP_153257478.1 site-specific DNA-methyltransferase -
  F1716_RS02145 (F1716_02160) - 340449..340802 (+) 354 WP_002787307.1 hypothetical protein -
  F1716_RS02150 (F1716_02165) - 340804..341010 (+) 207 WP_002787309.1 helix-turn-helix domain-containing protein -
  F1716_RS02155 (F1716_02170) - 341007..342182 (-) 1176 WP_002787311.1 site-specific integrase -
  F1716_RS02160 (F1716_02175) motB 342434..343177 (-) 744 WP_002854333.1 flagellar motor protein MotB -
  F1716_RS02165 (F1716_02180) motA 343180..343956 (-) 777 WP_002869732.1 flagellar motor stator protein MotA -
  F1716_RS02170 (F1716_02185) polA 343972..346611 (-) 2640 WP_070317316.1 DNA polymerase I -

Sequence


Protein


Download         Length: 213 a.a.        Molecular weight: 25007.42 Da        Isoelectric Point: 9.9709

>NTDB_id=391489 F1716_RS02055 WP_153257473.1 330985..331626(-) (CJE1441) [Campylobacter jejuni subsp. jejuni strain NADC 20827]
MKKLIILSLLSTLAFADYTQYKPSEDFAKYFAKQNCSQVLDKFYYDYSLKGTKAVAYRLEADNLKGEQIKKRPRFEDDTN
IPKKYRTTWSDYKNSGYDRGHTLSNASMRKTTQAQRSTFLMSNITPQNPQINQRVWNKIEKRERQVALKLGSLEVLNLVN
YDNNPQRIKNNIAIPSSYTKILKGDNFKECYQVPNHDVENENLRIYKVKCDNF

Nucleotide


Download         Length: 642 bp        

>NTDB_id=391489 F1716_RS02055 WP_153257473.1 330985..331626(-) (CJE1441) [Campylobacter jejuni subsp. jejuni strain NADC 20827]
ATGAAAAAACTTATAATCTTATCTTTATTATCCACTCTAGCTTTTGCTGATTATACACAATACAAACCAAGCGAAGATTT
TGCCAAGTATTTTGCTAAACAAAACTGCTCACAAGTTTTGGATAAATTTTATTATGATTATTCTTTAAAAGGCACTAAAG
CCGTAGCTTATAGATTAGAAGCGGATAATTTAAAAGGCGAACAAATCAAAAAACGCCCACGCTTTGAAGATGATACAAAT
ATTCCTAAAAAATACCGCACCACATGGAGTGATTATAAAAACAGCGGTTACGACAGGGGACACACTCTTTCTAATGCTTC
AATGAGAAAAACAACTCAAGCTCAAAGAAGCACTTTTTTAATGAGCAACATTACTCCACAAAATCCACAAATCAATCAAA
GAGTTTGGAATAAAATTGAAAAAAGAGAAAGACAAGTAGCTTTAAAGCTTGGAAGTTTAGAAGTTTTAAATTTGGTTAAT
TATGACAATAATCCACAAAGAATAAAAAACAATATTGCTATTCCAAGCTCTTACACTAAGATTTTAAAAGGTGATAATTT
TAAAGAATGTTACCAAGTGCCTAATCACGATGTAGAAAATGAGAATTTAAGAATATATAAAGTAAAATGTGACAATTTTT
AA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  CJE1441 Campylobacter jejuni RM1221

97.696

100

0.995

  CJE0566 Campylobacter jejuni RM1221

89.302

100

0.901


Multiple sequence alignment