Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   F8M43_RS12640 Genome accession   NZ_CP044498
Coordinates   2439581..2439964 (-) Length   127 a.a.
NCBI ID   WP_029726721.1    Uniprot ID   -
Organism   Bacillus subtilis strain ms-2     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2434581..2444964
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  F8M43_RS12600 sinI 2435515..2435688 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  F8M43_RS12605 sinR 2435722..2436057 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  F8M43_RS12610 tasA 2436150..2436935 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  F8M43_RS12615 sipW 2436999..2437571 (-) 573 WP_072692741.1 signal peptidase I SipW -
  F8M43_RS12620 tapA 2437555..2438316 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  F8M43_RS12625 yqzG 2438587..2438913 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  F8M43_RS12630 spoIITA 2438955..2439134 (-) 180 WP_029726723.1 YqzE family protein -
  F8M43_RS12635 comGG 2439206..2439580 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  F8M43_RS12640 comGF 2439581..2439964 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  F8M43_RS12645 comGE 2439990..2440337 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  F8M43_RS12650 comGD 2440321..2440752 (-) 432 WP_029726720.1 comG operon protein ComGD Machinery gene
  F8M43_RS12655 comGC 2440742..2441038 (-) 297 WP_029726719.1 comG operon protein ComGC Machinery gene
  F8M43_RS12660 comGB 2441052..2442089 (-) 1038 WP_029726718.1 comG operon protein ComGB Machinery gene
  F8M43_RS12665 comGA 2442076..2443146 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  F8M43_RS12670 - 2443359..2443556 (-) 198 WP_029726717.1 hypothetical protein -
  F8M43_RS12675 corA 2443558..2444511 (-) 954 WP_151433387.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14409.52 Da        Isoelectric Point: 5.8940

>NTDB_id=390565 F8M43_RS12640 WP_029726721.1 2439581..2439964(-) (comGF) [Bacillus subtilis strain ms-2]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADFENCVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=390565 F8M43_RS12640 WP_029726721.1 2439581..2439964(-) (comGF) [Bacillus subtilis strain ms-2]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGT
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATTGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

96.85

100

0.969


Multiple sequence alignment