Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   F6467_RS11785 Genome accession   NZ_CP044349
Coordinates   2439332..2439709 (-) Length   125 a.a.
NCBI ID   WP_032874019.1    Uniprot ID   -
Organism   Bacillus velezensis strain LC1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2434332..2444709
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  F6467_RS11745 (F6467_11745) - 2434829..2435623 (+) 795 WP_007612541.1 YqhG family protein -
  F6467_RS11750 (F6467_11750) sinI 2435800..2435973 (+) 174 WP_032874029.1 anti-repressor SinI Regulator
  F6467_RS11755 (F6467_11755) sinR 2436007..2436342 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  F6467_RS11760 (F6467_11760) tasA 2436390..2437175 (-) 786 WP_032874027.1 biofilm matrix protein TasA -
  F6467_RS11765 (F6467_11765) sipW 2437240..2437824 (-) 585 WP_032874025.1 signal peptidase I SipW -
  F6467_RS11770 (F6467_11770) tapA 2437796..2438467 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  F6467_RS11775 (F6467_11775) - 2438726..2439055 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  F6467_RS11780 (F6467_11780) - 2439096..2439275 (-) 180 WP_022552966.1 YqzE family protein -
  F6467_RS11785 (F6467_11785) comGG 2439332..2439709 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  F6467_RS11790 (F6467_11790) comGF 2439710..2440210 (-) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  F6467_RS11795 (F6467_11795) comGE 2440119..2440433 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  F6467_RS11800 (F6467_11800) comGD 2440417..2440854 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  F6467_RS11805 (F6467_11805) comGC 2440844..2441152 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  F6467_RS11810 (F6467_11810) comGB 2441157..2442194 (-) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  F6467_RS11815 (F6467_11815) comGA 2442181..2443251 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  F6467_RS11820 (F6467_11820) - 2443448..2444398 (-) 951 WP_032874012.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14077.01 Da        Isoelectric Point: 10.2236

>NTDB_id=389569 F6467_RS11785 WP_032874019.1 2439332..2439709(-) (comGG) [Bacillus velezensis strain LC1]
MSKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMAQGKKARTGTQRFPYGTVS
FHISGSDRRETVQVTIQTETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=389569 F6467_RS11785 WP_032874019.1 2439332..2439709(-) (comGG) [Bacillus velezensis strain LC1]
ATGTCCAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCAGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGGCACAGGGAAAAAAGGCCCGAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCTCCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGACGGAAACCACGACAGGTACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

49.194

99.2

0.488

Multiple sequence alignment