Detailed information    

insolico Bioinformatically predicted

Overview

Name   CJE0566   Type   Regulator
Locus tag   F4V32_RS01440 Genome accession   NZ_CP044161
Coordinates   277621..278283 (+) Length   220 a.a.
NCBI ID   WP_052784643.1    Uniprot ID   -
Organism   Campylobacter coli strain AR-0420     
Function   repress natural transformation (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 260410..295368 277621..278283 within 0


Gene organization within MGE regions


Location: 260410..295368
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  F4V32_RS01330 - 260410..261444 (-) 1035 WP_002792660.1 DUF5309 family protein -
  F4V32_RS01335 - 261673..261882 (+) 210 WP_052793181.1 hypothetical protein -
  F4V32_RS08940 - 261872..262039 (+) 168 WP_191904569.1 hypothetical protein -
  F4V32_RS08945 - 262051..262227 (+) 177 WP_002846376.1 hypothetical protein -
  F4V32_RS01340 - 262196..262642 (+) 447 WP_150966230.1 hypothetical protein -
  F4V32_RS01345 - 262729..266040 (-) 3312 WP_150966232.1 hypothetical protein -
  F4V32_RS09135 - 266053..267096 (-) 1044 WP_150966234.1 hypothetical protein -
  F4V32_RS01355 - 267360..267740 (-) 381 WP_002818601.1 hypothetical protein -
  F4V32_RS01360 - 267751..268398 (-) 648 WP_002784021.1 hypothetical protein -
  F4V32_RS01365 - 268388..268591 (-) 204 WP_000931940.1 hypothetical protein -
  F4V32_RS01370 - 268595..270112 (-) 1518 WP_057041416.1 hypothetical protein -
  F4V32_RS01375 - 270093..270365 (-) 273 WP_002781524.1 hypothetical protein -
  F4V32_RS01380 - 270355..271647 (-) 1293 WP_072213959.1 terminase large subunit domain-containing protein -
  F4V32_RS01385 - 271644..272030 (-) 387 WP_002795630.1 terminase small subunit -
  F4V32_RS01390 - 272030..272410 (-) 381 WP_072235914.1 crossover junction endodeoxyribonuclease RuvA -
  F4V32_RS01395 - 272428..273075 (-) 648 WP_002791798.1 hypothetical protein -
  F4V32_RS01400 - 273086..274087 (-) 1002 WP_150966236.1 hypothetical protein -
  F4V32_RS01405 - 274130..274516 (+) 387 WP_150966238.1 hypothetical protein -
  F4V32_RS08955 - 274631..274780 (+) 150 WP_002873586.1 hypothetical protein -
  F4V32_RS01410 - 274777..274965 (-) 189 WP_002784000.1 hypothetical protein -
  F4V32_RS01415 - 274962..275180 (-) 219 WP_002826741.1 hypothetical protein -
  F4V32_RS01420 - 275292..276026 (+) 735 WP_052784641.1 S24 family peptidase -
  F4V32_RS01425 - 276023..276430 (+) 408 WP_052780013.1 hypothetical protein -
  F4V32_RS01430 - 276412..277167 (+) 756 WP_150966240.1 hypothetical protein -
  F4V32_RS01435 - 277183..277608 (+) 426 WP_038831561.1 protein-export chaperone SecB -
  F4V32_RS01440 CJE0566 277621..278283 (+) 663 WP_052784643.1 DNA/RNA non-specific endonuclease Regulator
  F4V32_RS01445 - 278349..278852 (+) 504 WP_002840261.1 Panacea domain-containing protein -
  F4V32_RS01450 - 278839..279114 (+) 276 WP_002840259.1 hypothetical protein -
  F4V32_RS01455 - 279181..279603 (-) 423 WP_153886214.1 hypothetical protein -
  F4V32_RS01460 - 279797..280069 (+) 273 WP_002786773.1 hypothetical protein -
  F4V32_RS01465 - 280653..280922 (+) 270 WP_002783984.1 hypothetical protein -
  F4V32_RS01470 - 280913..281167 (+) 255 WP_053875343.1 hypothetical protein -
  F4V32_RS08960 - 281164..281316 (+) 153 WP_002795985.1 hypothetical protein -
  F4V32_RS01475 - 281309..281506 (-) 198 WP_002795988.1 hypothetical protein -
  F4V32_RS01480 - 281650..281832 (+) 183 WP_053875342.1 hypothetical protein -
  F4V32_RS01485 - 281829..282572 (+) 744 WP_150966242.1 phage regulatory protein/antirepressor Ant -
  F4V32_RS01490 - 282562..283416 (+) 855 WP_150966244.1 lambda-exonuclease family protein -
  F4V32_RS01495 - 283418..284152 (+) 735 WP_119752272.1 hypothetical protein -
  F4V32_RS01500 - 284152..284847 (+) 696 WP_002783960.1 hypothetical protein -
  F4V32_RS01505 - 284828..285106 (+) 279 WP_038853745.1 hypothetical protein -
  F4V32_RS01510 - 285087..285839 (+) 753 WP_032582843.1 site-specific DNA-methyltransferase -
  F4V32_RS01515 - 285893..286732 (+) 840 WP_002861640.1 hypothetical protein -
  F4V32_RS09140 - 286743..287378 (+) 636 WP_225305961.1 toxin-antitoxin system HicB family antitoxin -
  F4V32_RS01525 - 287509..288219 (+) 711 WP_150966246.1 Rha family transcriptional regulator -
  F4V32_RS01530 - 288222..288698 (+) 477 WP_225305962.1 YopX family protein -
  F4V32_RS01535 - 288695..289045 (+) 351 WP_002875041.1 hypothetical protein -
  F4V32_RS01540 - 289051..289698 (+) 648 WP_079464070.1 hypothetical protein -
  F4V32_RS01545 - 289846..290388 (+) 543 WP_150966247.1 pentapeptide repeat-containing protein -
  F4V32_RS01550 - 290381..290620 (+) 240 WP_002782521.1 helix-turn-helix domain-containing protein -
  F4V32_RS01555 - 290547..291746 (-) 1200 WP_002783946.1 site-specific integrase -
  F4V32_RS01565 - 292087..292425 (-) 339 WP_002785015.1 F0F1 ATP synthase subunit C -
  F4V32_RS01570 - 292671..294005 (+) 1335 WP_002785017.1 sodium-dependent transporter -
  F4V32_RS01575 - 294019..295368 (+) 1350 WP_002790562.1 sodium-dependent transporter -

Sequence

Protein


Download         Length: 220 a.a.        Molecular weight: 25811.44 Da        Isoelectric Point: 9.9612

>NTDB_id=388409 F4V32_RS01440 WP_052784643.1 277621..278283(+) (CJE0566) [Campylobacter coli strain AR-0420]
MKKIIILPLLATLALADYTQYKPSEDFARYFTKQSCSQVLDKFYYLNCYDYNLKGTKAVAYRLEAENLKGEQIKKRPRFE
DDTNIPKKYRTTWSDYRNSGYDRGHTLSNASMRKTTQAQRSTFLMSNITPQNPQINQRVWNKIEKRERQVALKLGSLEVL
NLVNYDNNPQRIRNQIAIPSSYIKILKGENFKECYQVPNHKVENENIKNYKVNCDILTGS

Nucleotide


Download         Length: 663 bp        

>NTDB_id=388409 F4V32_RS01440 WP_052784643.1 277621..278283(+) (CJE0566) [Campylobacter coli strain AR-0420]
ATGAAAAAAATTATAATCTTACCACTGCTAGCAACTCTAGCCTTAGCTGATTATACACAATACAAGCCAAGCGAAGATTT
TGCTAGGTATTTTACTAAGCAAAGTTGTTCACAAGTTTTAGATAAATTCTATTATCTAAATTGTTATGATTATAATCTAA
AAGGTACAAAAGCTGTAGCTTATAGATTGGAAGCGGAAAATTTAAAAGGCGAACAAATCAAAAAACGCCCACGCTTTGAA
GATGATACAAACATTCCTAAAAAATATCGCACTACATGGAGTGATTATAGAAACAGTGGTTATGATAGAGGACACACTCT
TTCTAATGCTTCTATGAGAAAAACAACTCAAGCTCAAAGAAGCACTTTTTTAATGAGTAATATTACTCCACAAAATCCAC
AAATCAATCAAAGGGTTTGGAACAAGATTGAAAAAAGAGAAAGACAAGTAGCTTTGAAGCTTGGAAGTTTAGAAGTTTTA
AATTTAGTTAATTATGACAATAATCCACAAAGAATAAGAAATCAAATTGCCATTCCAAGTTCTTATATTAAAATCTTAAA
AGGTGAGAATTTTAAAGAATGTTACCAAGTGCCAAACCATAAAGTAGAAAATGAGAATATAAAAAATTATAAGGTTAATT
GTGATATTTTAACCGGCAGTTGA

Domains

Predicted by InterproScan.

DNA/RNA non-specific endonuclease (Endonuclease_NS)

(29-215)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  CJE0566 Campylobacter jejuni RM1221

92.093

97.727

0.9
  CJE1441 Campylobacter jejuni RM1221

91.163

97.727

0.891

Multiple sequence alignment