Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   F3129_RS15155 Genome accession   NZ_CP044133
Coordinates   3072385..3072525 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain FJAT-46737     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3067385..3077525
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  F3129_RS15130 (F3129_15130) - 3067731..3068114 (-) 384 WP_012118312.1 hotdog fold thioesterase -
  F3129_RS15135 (F3129_15135) comA 3068136..3068780 (-) 645 WP_150941366.1 response regulator transcription factor Regulator
  F3129_RS15140 (F3129_15140) comP 3068861..3071161 (-) 2301 WP_032867184.1 histidine kinase Regulator
  F3129_RS15145 (F3129_15145) comX 3071175..3071348 (-) 174 WP_012118314.1 competence pheromone ComX -
  F3129_RS15150 (F3129_15150) - 3071317..3072177 (-) 861 WP_157774448.1 polyprenyl synthetase family protein -
  F3129_RS15155 (F3129_15155) degQ 3072385..3072525 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  F3129_RS15165 (F3129_15165) - 3072991..3073332 (+) 342 WP_025285192.1 hypothetical protein -
  F3129_RS15170 (F3129_15170) - 3073339..3074562 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  F3129_RS15175 (F3129_15175) - 3074692..3076158 (-) 1467 WP_015418109.1 nicotinate phosphoribosyltransferase -
  F3129_RS15180 (F3129_15180) - 3076176..3076727 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  F3129_RS15185 (F3129_15185) - 3076824..3077222 (-) 399 WP_020956272.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=388195 F3129_RS15155 WP_003152043.1 3072385..3072525(-) (degQ) [Bacillus velezensis strain FJAT-46737]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=388195 F3129_RS15155 WP_003152043.1 3072385..3072525(-) (degQ) [Bacillus velezensis strain FJAT-46737]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment