Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | F1612_RS04175 | Genome accession | NZ_CP043843 |
| Coordinates | 835405..835848 (+) | Length | 147 a.a. |
| NCBI ID | WP_001099009.1 | Uniprot ID | A0A0C6EXF8 |
| Organism | Staphylococcus aureus strain NCCP 16830 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 813362..867667 | 835405..835848 | within | 0 |
Gene organization within MGE regions
Location: 813362..867667
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| F1612_RS04015 (F1612_04100) | groES | 813362..813646 (+) | 285 | WP_000917289.1 | co-chaperone GroES | - |
| F1612_RS04020 (F1612_04105) | groL | 813722..815338 (+) | 1617 | WP_000240642.1 | chaperonin GroEL | - |
| F1612_RS04025 (F1612_04110) | - | 815875..816054 (+) | 180 | WP_000201397.1 | hypothetical protein | - |
| F1612_RS04030 (F1612_04115) | - | 816051..816677 (+) | 627 | WP_000216894.1 | hypothetical protein | - |
| F1612_RS04035 (F1612_04125) | - | 817249..818556 (-) | 1308 | WP_158172955.1 | TrkH family potassium uptake protein | - |
| F1612_RS04040 (F1612_04130) | - | 818717..819628 (+) | 912 | WP_000825510.1 | iron-hydroxamate ABC transporter substrate-binding protein | - |
| F1612_RS04045 (F1612_04135) | - | 819690..820535 (+) | 846 | WP_000812011.1 | class I SAM-dependent methyltransferase | - |
| F1612_RS04050 (F1612_04140) | - | 820907..822130 (-) | 1224 | WP_000206623.1 | ArgE/DapE family deacylase | - |
| F1612_RS04055 (F1612_04145) | lukH | 822566..823618 (+) | 1053 | WP_000791404.1 | bi-component leukocidin LukGH subunit H | - |
| F1612_RS04060 (F1612_04150) | lukG | 823640..824656 (+) | 1017 | WP_000595401.1 | bi-component leukocidin LukGH subunit G | - |
| F1612_RS04065 (F1612_04155) | sph | 824894..825718 (-) | 825 | Protein_793 | sphingomyelin phosphodiesterase | - |
| F1612_RS04070 (F1612_04160) | - | 825775..826812 (-) | 1038 | WP_000857198.1 | tyrosine-type recombinase/integrase | - |
| F1612_RS04075 (F1612_04165) | - | 827005..827709 (-) | 705 | WP_017804779.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| F1612_RS04080 (F1612_04170) | - | 827849..828016 (-) | 168 | WP_000705238.1 | hypothetical protein | - |
| F1612_RS04085 (F1612_04175) | - | 828220..828561 (-) | 342 | WP_000591749.1 | hypothetical protein | - |
| F1612_RS04090 (F1612_04180) | - | 828567..829499 (-) | 933 | WP_117221508.1 | exonuclease domain-containing protein | - |
| F1612_RS04095 (F1612_04185) | - | 829515..830228 (-) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| F1612_RS04100 (F1612_04190) | - | 830191..830365 (+) | 175 | Protein_800 | transcriptional regulator | - |
| F1612_RS04105 (F1612_04195) | - | 830362..830625 (+) | 264 | WP_000854072.1 | helix-turn-helix transcriptional regulator | - |
| F1612_RS04110 (F1612_04200) | - | 830641..830856 (+) | 216 | WP_001025404.1 | MW1434 family type I TA system toxin | - |
| F1612_RS04115 (F1612_04205) | - | 830845..831174 (-) | 330 | WP_158172956.1 | hypothetical protein | - |
| F1612_RS04120 (F1612_04210) | - | 831225..831977 (+) | 753 | WP_117221507.1 | phage antirepressor KilAC domain-containing protein | - |
| F1612_RS04125 (F1612_04215) | - | 831990..832250 (+) | 261 | WP_000435343.1 | hypothetical protein | - |
| F1612_RS14110 | - | 832274..832429 (-) | 156 | Protein_806 | hypothetical protein | - |
| F1612_RS04135 (F1612_04220) | - | 832484..832810 (+) | 327 | WP_001025595.1 | hypothetical protein | - |
| F1612_RS14115 | - | 832807..832906 (+) | 100 | Protein_808 | hypothetical protein | - |
| F1612_RS04145 (F1612_04230) | - | 833055..833378 (+) | 324 | WP_001120937.1 | DUF771 domain-containing protein | - |
| F1612_RS04150 (F1612_04235) | - | 833375..833536 (+) | 162 | WP_000048129.1 | DUF1270 family protein | - |
| F1612_RS04155 (F1612_04240) | - | 833626..833943 (+) | 318 | WP_000829610.1 | hypothetical protein | - |
| F1612_RS04160 (F1612_04245) | - | 833948..834208 (+) | 261 | WP_001556704.1 | DUF1108 family protein | - |
| F1612_RS04165 (F1612_04250) | - | 834221..834757 (+) | 537 | WP_001004336.1 | host-nuclease inhibitor Gam family protein | - |
| F1612_RS04170 (F1612_04255) | - | 834758..835408 (+) | 651 | WP_000840496.1 | ERF family protein | - |
| F1612_RS04175 (F1612_04260) | ssbA | 835405..835848 (+) | 444 | WP_001099009.1 | single-stranded DNA-binding protein | Machinery gene |
| F1612_RS04180 (F1612_04265) | - | 835860..836528 (+) | 669 | WP_053015335.1 | putative HNHc nuclease | - |
| F1612_RS04185 (F1612_04270) | - | 836714..837124 (-) | 411 | WP_158172958.1 | hypothetical protein | - |
| F1612_RS04190 (F1612_04275) | - | 837248..837655 (+) | 408 | WP_158172959.1 | HNH endonuclease | - |
| F1612_RS04195 (F1612_04280) | - | 837648..838370 (+) | 723 | WP_000031113.1 | helix-turn-helix domain-containing protein | - |
| F1612_RS04200 (F1612_04285) | - | 838380..839153 (+) | 774 | WP_000803046.1 | ATP-binding protein | - |
| F1612_RS04205 (F1612_04290) | - | 839147..839305 (+) | 159 | WP_000256594.1 | hypothetical protein | - |
| F1612_RS04210 (F1612_04295) | - | 839318..839539 (+) | 222 | WP_001123669.1 | DUF3269 family protein | - |
| F1612_RS04215 (F1612_04300) | - | 839551..839910 (+) | 360 | WP_153172343.1 | SA1788 family PVL leukocidin-associated protein | - |
| F1612_RS04220 (F1612_04305) | - | 839911..840159 (+) | 249 | WP_031774897.1 | phi PVL orf 51-like protein | - |
| F1612_RS04225 (F1612_04310) | - | 840172..840420 (+) | 249 | WP_001065065.1 | DUF1024 family protein | - |
| F1612_RS04230 (F1612_04315) | - | 840413..840922 (+) | 510 | WP_000185636.1 | dUTP diphosphatase | - |
| F1612_RS04235 (F1612_04320) | - | 840959..841204 (+) | 246 | WP_001282074.1 | hypothetical protein | - |
| F1612_RS04240 (F1612_04325) | - | 841201..841389 (+) | 189 | WP_000195782.1 | DUF1381 domain-containing protein | - |
| F1612_RS04245 (F1612_04330) | - | 841364..841564 (+) | 201 | WP_001125015.1 | hypothetical protein | - |
| F1612_RS04250 (F1612_04335) | rinB | 841567..841716 (+) | 150 | WP_000237868.1 | transcriptional activator RinB | - |
| F1612_RS04255 (F1612_04340) | - | 841875..842525 (+) | 651 | WP_001005262.1 | hypothetical protein | - |
| F1612_RS04260 (F1612_04345) | - | 842525..842725 (+) | 201 | WP_000265042.1 | DUF1514 family protein | - |
| F1612_RS04265 (F1612_04350) | - | 842753..843169 (+) | 417 | WP_000590122.1 | hypothetical protein | - |
| F1612_RS04270 (F1612_04355) | - | 843401..843700 (+) | 300 | WP_158172960.1 | HNH endonuclease | - |
| F1612_RS04275 (F1612_04360) | - | 843831..844175 (+) | 345 | WP_000402904.1 | hypothetical protein | - |
| F1612_RS04280 (F1612_04365) | - | 844172..845833 (+) | 1662 | WP_057521514.1 | terminase large subunit | - |
| F1612_RS04285 (F1612_04370) | - | 845849..847036 (+) | 1188 | WP_000025266.1 | phage portal protein | - |
| F1612_RS04290 (F1612_04375) | - | 847020..847757 (+) | 738 | WP_158172961.1 | head maturation protease, ClpP-related | - |
| F1612_RS04295 (F1612_04380) | - | 847780..848925 (+) | 1146 | WP_158172962.1 | phage major capsid protein | - |
| F1612_RS04300 (F1612_04385) | - | 848945..849228 (+) | 284 | Protein_840 | hypothetical protein | - |
| F1612_RS04305 (F1612_04390) | - | 849218..849502 (+) | 285 | WP_158172963.1 | phage head-tail adapter protein | - |
| F1612_RS04310 (F1612_04395) | - | 849486..849848 (+) | 363 | WP_111132017.1 | head-tail adaptor protein | - |
| F1612_RS04315 (F1612_04400) | - | 849845..850249 (+) | 405 | WP_111132018.1 | HK97 gp10 family phage protein | - |
| F1612_RS04320 (F1612_04405) | - | 850246..850653 (+) | 408 | WP_000565498.1 | hypothetical protein | - |
| F1612_RS04325 (F1612_04410) | - | 850654..851295 (+) | 642 | WP_000268738.1 | major tail protein | - |
| F1612_RS04330 (F1612_04415) | - | 851349..851561 (+) | 213 | WP_233265788.1 | Ig-like domain-containing protein | - |
| F1612_RS04335 (F1612_04420) | gpG | 851612..851962 (+) | 351 | WP_033857024.1 | phage tail assembly chaperone G | - |
| F1612_RS14215 | gpGT | 852013..852150 (+) | 138 | WP_033857023.1 | phage tail assembly chaperone GT | - |
| F1612_RS04340 (F1612_04425) | - | 852207..856751 (+) | 4545 | WP_158172964.1 | phage tail tape measure protein | - |
| F1612_RS04345 (F1612_04430) | - | 856748..858232 (+) | 1485 | WP_000567408.1 | phage distal tail protein | - |
| F1612_RS04350 (F1612_04435) | - | 858248..862033 (+) | 3786 | WP_158172965.1 | phage tail spike protein | - |
| F1612_RS04355 (F1612_04440) | - | 862023..862175 (+) | 153 | WP_001153681.1 | hypothetical protein | - |
| F1612_RS04360 (F1612_04445) | - | 862222..862509 (+) | 288 | WP_001040261.1 | hypothetical protein | - |
| F1612_RS04365 (F1612_04450) | - | 862567..862863 (+) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| F1612_RS04370 (F1612_04455) | pepG1 | 863055..863189 (+) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| F1612_RS04375 (F1612_04460) | - | 863242..863349 (-) | 108 | WP_001791821.1 | hypothetical protein | - |
| F1612_RS04380 (F1612_04465) | - | 863401..863655 (+) | 255 | WP_000611512.1 | phage holin | - |
| F1612_RS04385 (F1612_04470) | - | 863667..864422 (+) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| F1612_RS04390 (F1612_04475) | sak | 864612..865103 (+) | 492 | WP_000919350.1 | staphylokinase | - |
| F1612_RS04395 (F1612_04485) | - | 865749..866087 (+) | 339 | Protein_860 | SH3 domain-containing protein | - |
| F1612_RS04400 (F1612_04490) | - | 866182..866631 (-) | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| F1612_RS04405 (F1612_04495) | scn | 867317..867667 (+) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
Sequence
Protein
Download Length: 147 a.a. Molecular weight: 16321.89 Da Isoelectric Point: 5.8347
>NTDB_id=386153 F1612_RS04175 WP_001099009.1 835405..835848(+) (ssbA) [Staphylococcus aureus strain NCCP 16830]
MNTVNLIGNLVADPELKGQNNNVVNFVIAVQRPFKNKQTNEYETDFIRCVAFGKTAEIIANNFNKGNKIGVTGSIQTGSY
ENNQGQKVFTTDIAVNNITFVERKNNGQSNNQQQHNSYNAPQNRQQSNNPFANANGPIEISDDDLPF
MNTVNLIGNLVADPELKGQNNNVVNFVIAVQRPFKNKQTNEYETDFIRCVAFGKTAEIIANNFNKGNKIGVTGSIQTGSY
ENNQGQKVFTTDIAVNNITFVERKNNGQSNNQQQHNSYNAPQNRQQSNNPFANANGPIEISDDDLPF
Nucleotide
Download Length: 444 bp
>NTDB_id=386153 F1612_RS04175 WP_001099009.1 835405..835848(+) (ssbA) [Staphylococcus aureus strain NCCP 16830]
ATGAATACAGTAAATTTAATTGGGAACCTAGTGGCAGATCCAGAGTTAAAAGGTCAAAACAACAACGTAGTTAACTTTGT
AATCGCAGTACAGAGACCATTCAAAAACAAACAAACTAACGAATATGAAACAGACTTCATTCGTTGTGTTGCATTTGGTA
AGACTGCTGAAATCATCGCTAATAACTTTAATAAAGGTAATAAAATTGGCGTTACTGGTTCAATACAAACCGGTAGTTAT
GAAAATAATCAAGGACAGAAAGTGTTTACTACAGACATCGCAGTCAACAATATAACTTTCGTTGAACGTAAAAACAACGG
TCAATCTAACAACCAACAACAGCATAATTCATATAACGCACCACAGAATAGACAGCAATCAAATAATCCATTTGCTAATG
CTAATGGTCCTATAGAAATCTCTGACGATGATTTACCTTTCTAG
ATGAATACAGTAAATTTAATTGGGAACCTAGTGGCAGATCCAGAGTTAAAAGGTCAAAACAACAACGTAGTTAACTTTGT
AATCGCAGTACAGAGACCATTCAAAAACAAACAAACTAACGAATATGAAACAGACTTCATTCGTTGTGTTGCATTTGGTA
AGACTGCTGAAATCATCGCTAATAACTTTAATAAAGGTAATAAAATTGGCGTTACTGGTTCAATACAAACCGGTAGTTAT
GAAAATAATCAAGGACAGAAAGTGTTTACTACAGACATCGCAGTCAACAATATAACTTTCGTTGAACGTAAAAACAACGG
TCAATCTAACAACCAACAACAGCATAATTCATATAACGCACCACAGAATAGACAGCAATCAAATAATCCATTTGCTAATG
CTAATGGTCCTATAGAAATCTCTGACGATGATTTACCTTTCTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
41.279 |
100 |
0.483 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
38.235 |
100 |
0.442 |