Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HG582_RS00200 Genome accession   NZ_CP051534
Coordinates   37008..37121 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   Q9ZEL1
Organism   Helicobacter pylori strain LIM-009     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 32008..42121
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HG582_RS00175 (HG582_00175) - 32052..34277 (+) 2226 WP_202143931.1 ATP-dependent Clp protease ATP-binding subunit -
  HG582_RS00180 (HG582_00180) panD 34267..34620 (+) 354 WP_000142252.1 aspartate 1-decarboxylase -
  HG582_RS00185 (HG582_00185) - 34623..34925 (+) 303 WP_000347926.1 YbaB/EbfC family nucleoid-associated protein -
  HG582_RS00190 (HG582_00190) - 34925..35929 (+) 1005 WP_202143932.1 PDZ domain-containing protein -
  HG582_RS00195 (HG582_00195) comB6 35937..36992 (+) 1056 WP_202144352.1 P-type conjugative transfer protein TrbL Machinery gene
  HG582_RS00200 (HG582_00200) comB7 37008..37121 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  HG582_RS00205 (HG582_00205) comB8 37118..37861 (+) 744 WP_202143933.1 virB8 family protein Machinery gene
  HG582_RS00210 (HG582_00210) comB9 37861..38850 (+) 990 WP_202143934.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HG582_RS00215 (HG582_00215) comB10 38843..39973 (+) 1131 WP_202143935.1 DNA type IV secretion system protein ComB10 Machinery gene
  HG582_RS00220 (HG582_00220) - 40044..41462 (+) 1419 WP_202143936.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=385213 HG582_RS00200 WP_001217873.1 37008..37121(+) (comB7) [Helicobacter pylori strain LIM-009]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=385213 HG582_RS00200 WP_001217873.1 37008..37121(+) (comB7) [Helicobacter pylori strain LIM-009]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q9ZEL1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1