Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | BAMF_RS35660 | Genome accession | NC_014551 |
| Coordinates | 3031163..3031303 (-) | Length | 46 a.a. |
| NCBI ID | WP_013353398.1 | Uniprot ID | P06532 |
| Organism | Bacillus amyloliquefaciens DSM 7 = ATCC 23350 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3026163..3036303
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BAMF_RS35635 (BAMF_2966) | - | 3026482..3026865 (-) | 384 | WP_013353393.1 | hotdog fold thioesterase | - |
| BAMF_RS35640 (BAMF_2967) | comA | 3026887..3027531 (-) | 645 | WP_013353394.1 | response regulator transcription factor | Regulator |
| BAMF_RS35645 (BAMF_2968) | comP | 3027612..3029918 (-) | 2307 | WP_013353395.1 | sensor histidine kinase | Regulator |
| BAMF_RS35650 (BAMF_2969) | comX | 3029941..3030117 (-) | 177 | WP_013353396.1 | competence pheromone ComX | - |
| BAMF_RS35655 (BAMF_2970) | - | 3030136..3031011 (-) | 876 | WP_013353397.1 | polyprenyl synthetase family protein | - |
| BAMF_RS35660 (BAMF_2971) | degQ | 3031163..3031303 (-) | 141 | WP_013353398.1 | degradation enzyme regulation protein DegQ | Regulator |
| BAMF_RS35665 (BAMF_2972) | - | 3031768..3032109 (+) | 342 | WP_013353399.1 | hypothetical protein | - |
| BAMF_RS35670 (BAMF_2973) | - | 3032116..3033339 (-) | 1224 | WP_013353400.1 | EAL and HDOD domain-containing protein | - |
| BAMF_RS35675 (BAMF_2974) | - | 3033469..3034935 (-) | 1467 | WP_088030648.1 | nicotinate phosphoribosyltransferase | - |
| BAMF_RS35680 (BAMF_2975) | - | 3034953..3035504 (-) | 552 | WP_013353402.1 | cysteine hydrolase family protein | - |
| BAMF_RS35685 (BAMF_2976) | - | 3035585..3035980 (-) | 396 | WP_013353403.1 | YueI family protein | - |
| BAMF_RS35690 (BAMF_2977) | - | 3036046..3036294 (-) | 249 | WP_013353404.1 | YueH family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5532.37 Da Isoelectric Point: 6.2567
>NTDB_id=38507 BAMF_RS35660 WP_013353398.1 3031163..3031303(-) (degQ) [Bacillus amyloliquefaciens DSM 7 = ATCC 23350]
MEKKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MEKKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=38507 BAMF_RS35660 WP_013353398.1 3031163..3031303(-) (degQ) [Bacillus amyloliquefaciens DSM 7 = ATCC 23350]
GTGGAAAAGAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAAGAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
91.304 |
100 |
0.913 |