Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   BAMF_RS35660 Genome accession   NC_014551
Coordinates   3031163..3031303 (-) Length   46 a.a.
NCBI ID   WP_013353398.1    Uniprot ID   P06532
Organism   Bacillus amyloliquefaciens DSM 7 = ATCC 23350     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3026163..3036303
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BAMF_RS35635 (BAMF_2966) - 3026482..3026865 (-) 384 WP_013353393.1 hotdog fold thioesterase -
  BAMF_RS35640 (BAMF_2967) comA 3026887..3027531 (-) 645 WP_013353394.1 response regulator transcription factor Regulator
  BAMF_RS35645 (BAMF_2968) comP 3027612..3029918 (-) 2307 WP_013353395.1 sensor histidine kinase Regulator
  BAMF_RS35650 (BAMF_2969) comX 3029941..3030117 (-) 177 WP_013353396.1 competence pheromone ComX -
  BAMF_RS35655 (BAMF_2970) - 3030136..3031011 (-) 876 WP_013353397.1 polyprenyl synthetase family protein -
  BAMF_RS35660 (BAMF_2971) degQ 3031163..3031303 (-) 141 WP_013353398.1 degradation enzyme regulation protein DegQ Regulator
  BAMF_RS35665 (BAMF_2972) - 3031768..3032109 (+) 342 WP_013353399.1 hypothetical protein -
  BAMF_RS35670 (BAMF_2973) - 3032116..3033339 (-) 1224 WP_013353400.1 EAL and HDOD domain-containing protein -
  BAMF_RS35675 (BAMF_2974) - 3033469..3034935 (-) 1467 WP_088030648.1 nicotinate phosphoribosyltransferase -
  BAMF_RS35680 (BAMF_2975) - 3034953..3035504 (-) 552 WP_013353402.1 cysteine hydrolase family protein -
  BAMF_RS35685 (BAMF_2976) - 3035585..3035980 (-) 396 WP_013353403.1 YueI family protein -
  BAMF_RS35690 (BAMF_2977) - 3036046..3036294 (-) 249 WP_013353404.1 YueH family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5532.37 Da        Isoelectric Point: 6.2567

>NTDB_id=38507 BAMF_RS35660 WP_013353398.1 3031163..3031303(-) (degQ) [Bacillus amyloliquefaciens DSM 7 = ATCC 23350]
MEKKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=38507 BAMF_RS35660 WP_013353398.1 3031163..3031303(-) (degQ) [Bacillus amyloliquefaciens DSM 7 = ATCC 23350]
GTGGAAAAGAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB P06532

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

91.304

100

0.913


Multiple sequence alignment