Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HG568_RS00200 Genome accession   NZ_CP051499
Coordinates   33487..33600 (+) Length   37 a.a.
NCBI ID   WP_075645715.1    Uniprot ID   -
Organism   Helicobacter pylori strain PUNO-004     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 28487..38600
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HG568_RS00175 (HG568_00175) - 28526..30748 (+) 2223 WP_202167609.1 ATP-dependent Clp protease ATP-binding subunit -
  HG568_RS00180 (HG568_00180) panD 30738..31088 (+) 351 WP_000142282.1 aspartate 1-decarboxylase -
  HG568_RS00185 (HG568_00185) - 31099..31401 (+) 303 WP_000347918.1 YbaB/EbfC family nucleoid-associated protein -
  HG568_RS00190 (HG568_00190) - 31401..32408 (+) 1008 WP_202168078.1 PDZ domain-containing protein -
  HG568_RS00195 (HG568_00195) comB6 32416..33471 (+) 1056 WP_202168077.1 P-type conjugative transfer protein TrbL Machinery gene
  HG568_RS00200 (HG568_00200) comB7 33487..33600 (+) 114 WP_075645715.1 comB7 lipoprotein Machinery gene
  HG568_RS00205 (HG568_00205) comB8 33597..34340 (+) 744 WP_202167610.1 virB8 family protein Machinery gene
  HG568_RS00210 (HG568_00210) comB9 34340..35305 (+) 966 WP_202167611.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HG568_RS00215 (HG568_00215) comB10 35298..36434 (+) 1137 WP_202167612.1 DNA type IV secretion system protein ComB10 Machinery gene
  HG568_RS00220 (HG568_00220) - 36504..37916 (+) 1413 WP_202167613.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4305.26 Da        Isoelectric Point: 9.3572

>NTDB_id=384647 HG568_RS00200 WP_075645715.1 33487..33600(+) (comB7) [Helicobacter pylori strain PUNO-004]
MRIFFVIMGLILFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=384647 HG568_RS00200 WP_075645715.1 33487..33600(+) (comB7) [Helicobacter pylori strain PUNO-004]
ATGAGAATTTTTTTTGTCATTATGGGACTAATATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

94.595

100

0.946