Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HG570_RS00195 Genome accession   NZ_CP051497
Coordinates   33405..33518 (+) Length   37 a.a.
NCBI ID   WP_001217868.1    Uniprot ID   -
Organism   Helicobacter pylori strain PUNO-007     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 28405..38518
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HG570_RS00170 (HG570_00170) - 28455..30677 (+) 2223 WP_202141746.1 ATP-dependent Clp protease ATP-binding subunit -
  HG570_RS00175 (HG570_00175) panD 30667..31017 (+) 351 WP_202141747.1 aspartate 1-decarboxylase -
  HG570_RS00180 (HG570_00180) - 31028..31321 (+) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  HG570_RS00185 (HG570_00185) - 31321..32328 (+) 1008 WP_202142471.1 PDZ domain-containing protein -
  HG570_RS00190 (HG570_00190) comB6 32334..33389 (+) 1056 WP_202141748.1 P-type conjugative transfer protein TrbL Machinery gene
  HG570_RS00195 (HG570_00195) comB7 33405..33518 (+) 114 WP_001217868.1 hypothetical protein Machinery gene
  HG570_RS00200 (HG570_00200) comB8 33515..34258 (+) 744 WP_000660502.1 virB8 family protein Machinery gene
  HG570_RS00205 (HG570_00205) comB9 34258..35220 (+) 963 WP_202141749.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HG570_RS00210 (HG570_00210) comB10 35213..36349 (+) 1137 WP_202141750.1 DNA type IV secretion system protein ComB10 Machinery gene
  HG570_RS00215 (HG570_00215) - 36419..37831 (+) 1413 WP_202141751.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4323.29 Da        Isoelectric Point: 9.3572

>NTDB_id=384570 HG570_RS00195 WP_001217868.1 33405..33518(+) (comB7) [Helicobacter pylori strain PUNO-007]
MRIFFVIMGIMLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=384570 HG570_RS00195 WP_001217868.1 33405..33518(+) (comB7) [Helicobacter pylori strain PUNO-007]
ATGAGAATTTTTTTTGTCATTATGGGAATCATGTTATTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

91.892

100

0.919