Detailed information    

insolico Bioinformatically predicted

Overview

Name   phrC   Type   Regulator
Locus tag   BAMF_RS22165 Genome accession   NC_014551
Coordinates   388818..388937 (+) Length   39 a.a.
NCBI ID   WP_013351005.1    Uniprot ID   A0AAP7N4M9
Organism   Bacillus amyloliquefaciens DSM 7 = ATCC 23350     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context

Location: 383818..393937
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BAMF_RS22150 (BAMF_0342) - 385428..386111 (+) 684 WP_013351002.1 response regulator transcription factor -
  BAMF_RS22155 (BAMF_0343) - 386098..387525 (+) 1428 WP_161988189.1 sensor histidine kinase -
  BAMF_RS22160 (BAMF_0344) rapC 387686..388834 (+) 1149 WP_013351004.1 tetratricopeptide repeat protein Regulator
  BAMF_RS22165 (BAMF_0345) phrC 388818..388937 (+) 120 WP_013351005.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  BAMF_RS40525 (BAMF_0346) - 389085..389186 (-) 102 WP_013351006.1 YjcZ family sporulation protein -
  BAMF_RS22175 (BAMF_0347) - 389281..390645 (-) 1365 WP_013351007.1 aspartate kinase -
  BAMF_RS22180 (BAMF_0348) ceuB 391059..392012 (+) 954 WP_013351008.1 ABC transporter permease Machinery gene
  BAMF_RS22185 (BAMF_0349) - 392002..392949 (+) 948 WP_003156331.1 iron chelate uptake ABC transporter family permease subunit -
  BAMF_RS22190 (BAMF_0350) - 392943..393701 (+) 759 WP_013351009.1 ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=38457 BAMF_RS22165 WP_013351005.1 388818..388937(+) (phrC) [Bacillus amyloliquefaciens DSM 7 = ATCC 23350]
MKLKSKWFVICLAAAAIFTAAGVSQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=38457 BAMF_RS22165 WP_013351005.1 388818..388937(+) (phrC) [Bacillus amyloliquefaciens DSM 7 = ATCC 23350]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGCTGCAGGTGTAAGCCAGACAGA
TCAGGCTGAATTCCATGTGGCTGAAAGAGGAATGACGTGA

Domains

Predicted by InterproScan.

Rap-phr extracellular signalling (PhrC_PhrF)

(3-39)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

80

100

0.821

Multiple sequence alignment