Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   FZE25_RS14920 Genome accession   NZ_CP043416
Coordinates   2999349..2999489 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain ONU 553     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 2994349..3004489
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FZE25_RS14895 (FZE25_14645) - 2994689..2995072 (-) 384 WP_007408674.1 hotdog fold thioesterase -
  FZE25_RS14900 (FZE25_14650) comA 2995094..2995738 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  FZE25_RS14905 (FZE25_14655) comP 2995819..2998110 (-) 2292 WP_042635452.1 histidine kinase Regulator
  FZE25_RS14910 (FZE25_14660) comX 2998122..2998286 (-) 165 WP_007613432.1 competence pheromone ComX -
  FZE25_RS14915 (FZE25_14665) - 2998286..2999197 (-) 912 WP_079891433.1 polyprenyl synthetase family protein -
  FZE25_RS14920 (FZE25_14670) degQ 2999349..2999489 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  FZE25_RS14930 (FZE25_14675) - 2999954..3000295 (+) 342 WP_042635453.1 hypothetical protein -
  FZE25_RS14935 (FZE25_14680) - 3000302..3001525 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  FZE25_RS14940 (FZE25_14685) - 3001655..3003121 (-) 1467 WP_020954301.1 nicotinate phosphoribosyltransferase -
  FZE25_RS14945 (FZE25_14690) - 3003139..3003690 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  FZE25_RS14950 (FZE25_14695) - 3003787..3004185 (-) 399 WP_042635454.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=383706 FZE25_RS14920 WP_003152043.1 2999349..2999489(-) (degQ) [Bacillus velezensis strain ONU 553]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=383706 FZE25_RS14920 WP_003152043.1 2999349..2999489(-) (degQ) [Bacillus velezensis strain ONU 553]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891


Multiple sequence alignment