Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | FZE25_RS11915 | Genome accession | NZ_CP043416 |
| Coordinates | 2441289..2441462 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain ONU 553 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2436289..2446462
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FZE25_RS11900 (FZE25_11695) | gcvT | 2437102..2438202 (-) | 1101 | WP_042635355.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| FZE25_RS11905 (FZE25_11700) | - | 2438626..2440296 (+) | 1671 | WP_031378948.1 | DEAD/DEAH box helicase | - |
| FZE25_RS11910 (FZE25_11705) | - | 2440318..2441112 (+) | 795 | WP_007408330.1 | YqhG family protein | - |
| FZE25_RS11915 (FZE25_11710) | sinI | 2441289..2441462 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| FZE25_RS11920 (FZE25_11715) | sinR | 2441496..2441831 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| FZE25_RS11925 (FZE25_11720) | tasA | 2441879..2442664 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| FZE25_RS11930 (FZE25_11725) | sipW | 2442729..2443313 (-) | 585 | WP_007408328.1 | signal peptidase I SipW | - |
| FZE25_RS11935 (FZE25_11730) | tapA | 2443285..2443956 (-) | 672 | WP_042635356.1 | amyloid fiber anchoring/assembly protein TapA | - |
| FZE25_RS11940 (FZE25_11735) | - | 2444215..2444544 (+) | 330 | WP_020954231.1 | DUF3889 domain-containing protein | - |
| FZE25_RS11945 (FZE25_11740) | - | 2444584..2444763 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| FZE25_RS11950 (FZE25_11745) | comGG | 2444820..2445197 (-) | 378 | WP_032866434.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| FZE25_RS11955 (FZE25_11750) | comGF | 2445198..2445698 (-) | 501 | WP_262982688.1 | competence type IV pilus minor pilin ComGF | - |
| FZE25_RS11960 (FZE25_11755) | comGE | 2445607..2445921 (-) | 315 | WP_007408323.1 | competence type IV pilus minor pilin ComGE | - |
| FZE25_RS11965 (FZE25_11760) | comGD | 2445905..2446342 (-) | 438 | WP_012117983.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=383685 FZE25_RS11915 WP_003153105.1 2441289..2441462(+) (sinI) [Bacillus velezensis strain ONU 553]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=383685 FZE25_RS11915 WP_003153105.1 2441289..2441462(+) (sinI) [Bacillus velezensis strain ONU 553]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |