Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   FZE25_RS11950 Genome accession   NZ_CP043416
Coordinates   2444820..2445197 (-) Length   125 a.a.
NCBI ID   WP_032866434.1    Uniprot ID   -
Organism   Bacillus velezensis strain ONU 553     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2439820..2450197
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FZE25_RS11910 (FZE25_11705) - 2440318..2441112 (+) 795 WP_007408330.1 YqhG family protein -
  FZE25_RS11915 (FZE25_11710) sinI 2441289..2441462 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  FZE25_RS11920 (FZE25_11715) sinR 2441496..2441831 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  FZE25_RS11925 (FZE25_11720) tasA 2441879..2442664 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  FZE25_RS11930 (FZE25_11725) sipW 2442729..2443313 (-) 585 WP_007408328.1 signal peptidase I SipW -
  FZE25_RS11935 (FZE25_11730) tapA 2443285..2443956 (-) 672 WP_042635356.1 amyloid fiber anchoring/assembly protein TapA -
  FZE25_RS11940 (FZE25_11735) - 2444215..2444544 (+) 330 WP_020954231.1 DUF3889 domain-containing protein -
  FZE25_RS11945 (FZE25_11740) - 2444584..2444763 (-) 180 WP_003153093.1 YqzE family protein -
  FZE25_RS11950 (FZE25_11745) comGG 2444820..2445197 (-) 378 WP_032866434.1 competence type IV pilus minor pilin ComGG Machinery gene
  FZE25_RS11955 (FZE25_11750) comGF 2445198..2445698 (-) 501 WP_262982688.1 competence type IV pilus minor pilin ComGF -
  FZE25_RS11960 (FZE25_11755) comGE 2445607..2445921 (-) 315 WP_007408323.1 competence type IV pilus minor pilin ComGE -
  FZE25_RS11965 (FZE25_11760) comGD 2445905..2446342 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  FZE25_RS11970 (FZE25_11765) comGC 2446332..2446640 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  FZE25_RS11975 (FZE25_11770) comGB 2446645..2447682 (-) 1038 WP_032866436.1 competence type IV pilus assembly protein ComGB Machinery gene
  FZE25_RS11980 (FZE25_11775) comGA 2447669..2448739 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  FZE25_RS11985 (FZE25_11780) - 2448931..2449881 (-) 951 WP_032870601.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14197.08 Da        Isoelectric Point: 9.7381

>NTDB_id=383687 FZE25_RS11950 WP_032866434.1 2444820..2445197(-) (comGG) [Bacillus velezensis strain ONU 553]
MYKSDGFIYPAVLFVSAAVLLVISYTTSDFITRKTFAKEAGEYWTGENLLQNGALLSSRHMTQGQRVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=383687 FZE25_RS11950 WP_032866434.1 2444820..2445197(-) (comGG) [Bacillus velezensis strain ONU 553]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTAC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGACCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAGGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGGCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

49.194

99.2

0.488

Multiple sequence alignment