Detailed information
Bioinformatically predicted
Overview
| Name | degQ | Type | Regulator |
| Locus tag | FX981_RS12075 | Genome accession | NZ_CP043404 |
| Coordinates | 2432409..2432549 (+) | Length | 46 a.a. |
| NCBI ID | WP_003213123.1 | Uniprot ID | A0A5K1N966 |
| Organism | Bacillus safensis strain PgKB20 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2427409..2437549
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FX981_RS12050 (FX981_02423) | - | 2427638..2428045 (+) | 408 | WP_024423329.1 | YueI family protein | - |
| FX981_RS12055 (FX981_02424) | - | 2428106..2428657 (+) | 552 | WP_149126319.1 | cysteine hydrolase family protein | - |
| FX981_RS12060 (FX981_02425) | - | 2428735..2430147 (+) | 1413 | WP_229137464.1 | nicotinate phosphoribosyltransferase | - |
| FX981_RS12065 (FX981_02426) | - | 2430285..2431511 (+) | 1227 | WP_024425947.1 | EAL and HDOD domain-containing protein | - |
| FX981_RS12070 (FX981_02427) | - | 2431547..2431903 (-) | 357 | WP_024425946.1 | hypothetical protein | - |
| FX981_RS12075 (FX981_02428) | degQ | 2432409..2432549 (+) | 141 | WP_003213123.1 | degradation enzyme regulation protein DegQ | Regulator |
| FX981_RS12080 (FX981_02429) | - | 2432701..2433624 (+) | 924 | WP_024425945.1 | polyprenyl synthetase family protein | - |
| FX981_RS12085 (FX981_02430) | comX | 2433602..2433775 (+) | 174 | WP_024425944.1 | competence pheromone ComX | - |
| FX981_RS12090 (FX981_02431) | comP | 2433789..2436080 (+) | 2292 | WP_024425943.1 | ATP-binding protein | Regulator |
| FX981_RS12095 (FX981_02432) | comA | 2436161..2436802 (+) | 642 | WP_024423322.1 | response regulator transcription factor | Regulator |
| FX981_RS12100 (FX981_02433) | - | 2436826..2437215 (+) | 390 | WP_024423321.1 | hotdog fold thioesterase | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5677.42 Da Isoelectric Point: 4.6828
>NTDB_id=383514 FX981_RS12075 WP_003213123.1 2432409..2432549(+) (degQ) [Bacillus safensis strain PgKB20]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=383514 FX981_RS12075 WP_003213123.1 2432409..2432549(+) (degQ) [Bacillus safensis strain PgKB20]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATCAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATCAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
68.085 |
100 |
0.696 |